BLASTX nr result
ID: Astragalus24_contig00026544
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00026544 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30304.3| unnamed protein product, partial [Vitis vinifera] 72 8e-12 >emb|CBI30304.3| unnamed protein product, partial [Vitis vinifera] Length = 461 Score = 71.6 bits (174), Expect = 8e-12 Identities = 34/47 (72%), Positives = 36/47 (76%) Frame = -1 Query: 143 MAQTQSKFFLCFSIWPLILFPPFVICYLSSMNASGFCASFTVALQAF 3 MA QS+F LC S WP ILFPPF IC LSS NASGF ASFTV LQA+ Sbjct: 1 MAHIQSRFLLCNSFWPFILFPPFPICSLSSANASGFFASFTVVLQAY 47