BLASTX nr result
ID: Astragalus24_contig00026521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00026521 (306 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU12293.1| hypothetical protein TSUD_142020 [Trifolium subt... 53 5e-06 >dbj|GAU12293.1| hypothetical protein TSUD_142020 [Trifolium subterraneum] Length = 228 Score = 53.1 bits (126), Expect = 5e-06 Identities = 24/55 (43%), Positives = 34/55 (61%) Frame = -3 Query: 196 VFQFAVFNGHWVCYVLNKHERNMYVLDSLEHERNENWFLLDLAMCTRFEELLSII 32 +F ++ HW CYVL+K ++VL+SL ERNE LLDL+M FE L+ + Sbjct: 77 IFAPTIYEEHWFCYVLDKRNNKLFVLNSLSSERNEENKLLDLSMKRHFEMFLNFM 131