BLASTX nr result
ID: Astragalus24_contig00026088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00026088 (553 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625583.1| interactor of constitutive active ROPs-like ... 75 1e-12 ref|XP_004493948.1| PREDICTED: interactor of constitutive active... 73 1e-11 gb|KYP70845.1| hypothetical protein KK1_010083 [Cajanus cajan] 70 8e-11 ref|XP_020210905.1| interactor of constitutive active ROPs 2, ch... 70 8e-11 ref|XP_021666891.1| interactor of constitutive active ROPs 2, ch... 70 8e-11 ref|XP_006577009.1| PREDICTED: interactor of constitutive active... 70 1e-10 ref|XP_003520644.1| PREDICTED: interactor of constitutive active... 70 1e-10 ref|XP_015969987.1| interactor of constitutive active ROPs 2, ch... 69 4e-10 ref|XP_021636107.1| interactor of constitutive active ROPs 2, ch... 68 5e-10 ref|XP_021621113.1| interactor of constitutive active ROPs 2, ch... 68 7e-10 ref|XP_021622210.1| interactor of constitutive active ROPs 2, ch... 67 2e-09 gb|OMO73494.1| Ribosomal protein S23, eukaryotic/archaeal [Corch... 67 2e-09 ref|XP_021666892.1| interactor of constitutive active ROPs 2, ch... 66 2e-09 ref|XP_016207969.1| interactor of constitutive active ROPs 2, ch... 66 2e-09 ref|XP_012082289.1| interactor of constitutive active ROPs 2, ch... 66 2e-09 gb|KJB33004.1| hypothetical protein B456_006G1686001 [Gossypium ... 66 3e-09 gb|KJB33006.1| hypothetical protein B456_006G1686001 [Gossypium ... 66 3e-09 ref|XP_016671247.1| PREDICTED: interactor of constitutive active... 66 3e-09 ref|XP_012486019.1| PREDICTED: interactor of constitutive active... 66 3e-09 ref|XP_006604555.1| PREDICTED: interactor of constitutive active... 65 4e-09 >ref|XP_003625583.1| interactor of constitutive active ROPs-like protein [Medicago truncatula] gb|AES81801.1| interactor of constitutive active ROPs-like protein [Medicago truncatula] Length = 610 Score = 75.5 bits (184), Expect = 1e-12 Identities = 43/72 (59%), Positives = 49/72 (68%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPKA R+SA E+ Q+KSP++TPRTARQLK NP RKTP D SP V Sbjct: 1 MQTPKA--RSSAPEMSQRKSPAATPRTARQLKTPNSGSNSASSSPNPIRKTPKDMSPRVN 58 Query: 38 ERRSSYSPISEK 3 ERR S+SPISEK Sbjct: 59 ERRLSHSPISEK 70 >ref|XP_004493948.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Cicer arietinum] ref|XP_004493949.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Cicer arietinum] ref|XP_004493950.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Cicer arietinum] ref|XP_012569437.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Cicer arietinum] ref|XP_012569438.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Cicer arietinum] Length = 618 Score = 72.8 bits (177), Expect = 1e-11 Identities = 42/72 (58%), Positives = 47/72 (65%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPKA RASASE+PQ+KSP + ARQLK NP RK P DRSP V+ Sbjct: 1 MQTPKA--RASASELPQRKSPVTPRAAARQLKTPNSGSNSASSSPNPLRKLPKDRSPKVI 58 Query: 38 ERRSSYSPISEK 3 ERR S+SPISEK Sbjct: 59 ERRLSHSPISEK 70 >gb|KYP70845.1| hypothetical protein KK1_010083 [Cajanus cajan] Length = 605 Score = 70.5 bits (171), Expect = 8e-11 Identities = 44/72 (61%), Positives = 47/72 (65%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPKA RA SEVPQKKSP TPRTARQLKI +KTP +RSP VV Sbjct: 1 MQTPKA--RAGTSEVPQKKSPV-TPRTARQLKIPNSDSDLVSSPNA-AKKTPKNRSPKVV 56 Query: 38 ERRSSYSPISEK 3 ERRS SP+SEK Sbjct: 57 ERRSPQSPVSEK 68 >ref|XP_020210905.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] ref|XP_020210906.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] Length = 618 Score = 70.5 bits (171), Expect = 8e-11 Identities = 44/72 (61%), Positives = 47/72 (65%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPKA RA SEVPQKKSP TPRTARQLKI +KTP +RSP VV Sbjct: 1 MQTPKA--RAGTSEVPQKKSPV-TPRTARQLKIPNSDSDLVSSPNA-AKKTPKNRSPKVV 56 Query: 38 ERRSSYSPISEK 3 ERRS SP+SEK Sbjct: 57 ERRSPQSPVSEK 68 >ref|XP_021666891.1| interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Hevea brasiliensis] Length = 679 Score = 70.5 bits (171), Expect = 8e-11 Identities = 46/96 (47%), Positives = 57/96 (59%), Gaps = 3/96 (3%) Frame = -3 Query: 281 GKGLRRRGL---FHCISITQRDSNMQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXX 111 G G ++R F + + +R+ MQTPKA RA +SEVPQ+KSP+ TPRTARQL I Sbjct: 35 GGGFKKRTYNFPFLSLILRKREKAMQTPKA--RAGSSEVPQRKSPA-TPRTARQLNIPGL 91 Query: 110 XXXXXXXXXNPTRKTPTDRSPNVVERRSSYSPISEK 3 P KTP D+SP V ERRS SP +EK Sbjct: 92 DSDSLSPN--PASKTPKDKSPKVPERRSPRSPATEK 125 >ref|XP_006577009.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Glycine max] gb|KRH67644.1| hypothetical protein GLYMA_03G178100 [Glycine max] Length = 620 Score = 69.7 bits (169), Expect = 1e-10 Identities = 43/72 (59%), Positives = 47/72 (65%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPKA R ASEVPQKKSP+ TPRTARQLK +KTP DRSP V+ Sbjct: 1 MQTPKA--RVGASEVPQKKSPA-TPRTARQLKTPNSDAYSVSSPNA-AKKTPKDRSPKVI 56 Query: 38 ERRSSYSPISEK 3 E RS +SPISEK Sbjct: 57 ECRSPHSPISEK 68 >ref|XP_003520644.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] gb|KHN09475.1| Interactor of constitutive active ROPs 2, chloroplastic [Glycine soja] gb|KRH67645.1| hypothetical protein GLYMA_03G178100 [Glycine max] Length = 621 Score = 69.7 bits (169), Expect = 1e-10 Identities = 43/72 (59%), Positives = 47/72 (65%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPKA R ASEVPQKKSP+ TPRTARQLK +KTP DRSP V+ Sbjct: 1 MQTPKA--RVGASEVPQKKSPA-TPRTARQLKTPNSDAYSVSSPNA-AKKTPKDRSPKVI 56 Query: 38 ERRSSYSPISEK 3 E RS +SPISEK Sbjct: 57 ECRSPHSPISEK 68 >ref|XP_015969987.1| interactor of constitutive active ROPs 2, chloroplastic-like [Arachis duranensis] ref|XP_015969988.1| interactor of constitutive active ROPs 2, chloroplastic-like [Arachis duranensis] ref|XP_015969989.1| interactor of constitutive active ROPs 2, chloroplastic-like [Arachis duranensis] ref|XP_020980236.1| interactor of constitutive active ROPs 2, chloroplastic-like [Arachis duranensis] Length = 623 Score = 68.6 bits (166), Expect = 4e-10 Identities = 38/72 (52%), Positives = 46/72 (63%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 M TPKA R ++SE+PQ+KSP +TPRTAR LK NP RK+ DRSP V+ Sbjct: 1 MHTPKA--RTNSSEMPQRKSPVNTPRTARMLKTPNSDSDSLSSSPNPARKSLKDRSPKVI 58 Query: 38 ERRSSYSPISEK 3 E RS SPI+EK Sbjct: 59 EHRSPQSPITEK 70 >ref|XP_021636107.1| interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Hevea brasiliensis] ref|XP_021636115.1| interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Hevea brasiliensis] ref|XP_021636121.1| interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Hevea brasiliensis] ref|XP_021636128.1| interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Hevea brasiliensis] Length = 605 Score = 68.2 bits (165), Expect = 5e-10 Identities = 42/72 (58%), Positives = 47/72 (65%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPKA RA +SEVPQ+KSP+ TPRTARQLKI P KTP D+SP V Sbjct: 1 MQTPKA--RAGSSEVPQRKSPA-TPRTARQLKIPGSDSDSLSPN--PASKTPKDKSPKVP 55 Query: 38 ERRSSYSPISEK 3 ERRS SP +EK Sbjct: 56 ERRSPRSPATEK 67 >ref|XP_021621113.1| interactor of constitutive active ROPs 2, chloroplastic-like [Manihot esculenta] gb|OAY42634.1| hypothetical protein MANES_08G003600 [Manihot esculenta] gb|OAY42636.1| hypothetical protein MANES_08G003600 [Manihot esculenta] gb|OAY42637.1| hypothetical protein MANES_08G003600 [Manihot esculenta] Length = 622 Score = 67.8 bits (164), Expect = 7e-10 Identities = 42/72 (58%), Positives = 47/72 (65%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPKA RA +SEVPQ+KSPS TPRTARQLKI P KTP ++SP V Sbjct: 1 MQTPKA--RAGSSEVPQRKSPS-TPRTARQLKIPGSGSDSLSPN--PASKTPKEKSPKVP 55 Query: 38 ERRSSYSPISEK 3 ERRS SP +EK Sbjct: 56 ERRSPRSPATEK 67 >ref|XP_021622210.1| interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Manihot esculenta] ref|XP_021622211.1| interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Manihot esculenta] ref|XP_021622212.1| interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Manihot esculenta] ref|XP_021622214.1| interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Manihot esculenta] ref|XP_021622215.1| interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Manihot esculenta] gb|OAY41188.1| hypothetical protein MANES_09G080900 [Manihot esculenta] gb|OAY41189.1| hypothetical protein MANES_09G080900 [Manihot esculenta] Length = 623 Score = 66.6 bits (161), Expect = 2e-09 Identities = 40/72 (55%), Positives = 49/72 (68%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPKA+A S++E+PQ+KSP+ TPRTAR+LKI PT KTP D++P V Sbjct: 1 MQTPKARA-GSSTELPQRKSPA-TPRTARKLKIPGPDSDSPSVN--PTSKTPKDKTPKVH 56 Query: 38 ERRSSYSPISEK 3 ERRS SP SEK Sbjct: 57 ERRSPRSPASEK 68 >gb|OMO73494.1| Ribosomal protein S23, eukaryotic/archaeal [Corchorus olitorius] Length = 810 Score = 66.6 bits (161), Expect = 2e-09 Identities = 44/92 (47%), Positives = 52/92 (56%), Gaps = 3/92 (3%) Frame = -3 Query: 269 RRRGLFHCISITQRDSN---MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXX 99 +RR + C T N MQTPK +R S EVPQ+KSP+ TPRTARQLK Sbjct: 13 QRRHISCCPFATSTQDNIKIMQTPKG-SRVSTLEVPQRKSPA-TPRTARQLKTPGSDSDT 70 Query: 98 XXXXXNPTRKTPTDRSPNVVERRSSYSPISEK 3 P KTP DRSP V ER++ SP+SEK Sbjct: 71 VPSPN-PASKTPKDRSPKVTERKALRSPVSEK 101 >ref|XP_021666892.1| interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Hevea brasiliensis] ref|XP_021666893.1| interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Hevea brasiliensis] ref|XP_021666894.1| interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Hevea brasiliensis] Length = 621 Score = 66.2 bits (160), Expect = 2e-09 Identities = 41/72 (56%), Positives = 46/72 (63%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPKA RA +SEVPQ+KSP+ TPRTARQL I P KTP D+SP V Sbjct: 1 MQTPKA--RAGSSEVPQRKSPA-TPRTARQLNIPGLDSDSLSPN--PASKTPKDKSPKVP 55 Query: 38 ERRSSYSPISEK 3 ERRS SP +EK Sbjct: 56 ERRSPRSPATEK 67 >ref|XP_016207969.1| interactor of constitutive active ROPs 2, chloroplastic-like [Arachis ipaensis] ref|XP_016207970.1| interactor of constitutive active ROPs 2, chloroplastic-like [Arachis ipaensis] ref|XP_016207971.1| interactor of constitutive active ROPs 2, chloroplastic-like [Arachis ipaensis] ref|XP_020960023.1| interactor of constitutive active ROPs 2, chloroplastic-like [Arachis ipaensis] ref|XP_020960024.1| interactor of constitutive active ROPs 2, chloroplastic-like [Arachis ipaensis] Length = 623 Score = 66.2 bits (160), Expect = 2e-09 Identities = 38/72 (52%), Positives = 45/72 (62%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 M TPKA R ++SE+PQ+KSP +TPRTAR LK NP RK+ DRSP V Sbjct: 1 MHTPKA--RTNSSEMPQRKSPVNTPRTARMLKTPNSDSDSLSSSPNPARKSLKDRSPKVN 58 Query: 38 ERRSSYSPISEK 3 E RS SPI+EK Sbjct: 59 EHRSPQSPITEK 70 >ref|XP_012082289.1| interactor of constitutive active ROPs 2, chloroplastic [Jatropha curcas] gb|KDP29076.1| hypothetical protein JCGZ_16465 [Jatropha curcas] Length = 623 Score = 66.2 bits (160), Expect = 2e-09 Identities = 40/72 (55%), Positives = 47/72 (65%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPKA R +SEVPQ+KS ++TPRTARQLKI P KTP D+SP V+ Sbjct: 1 MQTPKA--RTGSSEVPQRKS-AATPRTARQLKIPGSDSDSVPSPN-PASKTPKDKSPKVI 56 Query: 38 ERRSSYSPISEK 3 ERRS SP +EK Sbjct: 57 ERRSPRSPATEK 68 >gb|KJB33004.1| hypothetical protein B456_006G1686001 [Gossypium raimondii] Length = 425 Score = 65.9 bits (159), Expect = 3e-09 Identities = 39/72 (54%), Positives = 47/72 (65%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPK +R S++EVPQ+KSP+ TPRTARQLKI P KTP DRSP V Sbjct: 1 MQTPKG-SRTSSAEVPQRKSPA-TPRTARQLKIPGSDSEAVSSPN-PASKTPKDRSPKVT 57 Query: 38 ERRSSYSPISEK 3 ER+ SP++EK Sbjct: 58 ERKVLRSPVAEK 69 >gb|KJB33006.1| hypothetical protein B456_006G1686001 [Gossypium raimondii] Length = 619 Score = 65.9 bits (159), Expect = 3e-09 Identities = 39/72 (54%), Positives = 47/72 (65%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPK +R S++EVPQ+KSP+ TPRTARQLKI P KTP DRSP V Sbjct: 1 MQTPKG-SRTSSAEVPQRKSPA-TPRTARQLKIPGSDSEAVSSPN-PASKTPKDRSPKVT 57 Query: 38 ERRSSYSPISEK 3 ER+ SP++EK Sbjct: 58 ERKVLRSPVAEK 69 >ref|XP_016671247.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Gossypium hirsutum] ref|XP_016671249.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Gossypium hirsutum] Length = 620 Score = 65.9 bits (159), Expect = 3e-09 Identities = 39/72 (54%), Positives = 47/72 (65%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPK +R S++EVPQ+KSP+ TPRTARQLKI P KTP DRSP V Sbjct: 1 MQTPKG-SRTSSAEVPQRKSPA-TPRTARQLKIPGSDSEAVSSPN-PASKTPKDRSPKVT 57 Query: 38 ERRSSYSPISEK 3 ER+ SP++EK Sbjct: 58 ERKVLRSPVAEK 69 >ref|XP_012486019.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic isoform X1 [Gossypium raimondii] ref|XP_012486020.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic isoform X1 [Gossypium raimondii] gb|KJB33003.1| hypothetical protein B456_006G1686001 [Gossypium raimondii] gb|KJB33008.1| hypothetical protein B456_006G1686001 [Gossypium raimondii] gb|KJB33009.1| hypothetical protein B456_006G1686001 [Gossypium raimondii] gb|KJB33010.1| hypothetical protein B456_006G1686001 [Gossypium raimondii] Length = 620 Score = 65.9 bits (159), Expect = 3e-09 Identities = 39/72 (54%), Positives = 47/72 (65%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPK +R S++EVPQ+KSP+ TPRTARQLKI P KTP DRSP V Sbjct: 1 MQTPKG-SRTSSAEVPQRKSPA-TPRTARQLKIPGSDSEAVSSPN-PASKTPKDRSPKVT 57 Query: 38 ERRSSYSPISEK 3 ER+ SP++EK Sbjct: 58 ERKVLRSPVAEK 69 >ref|XP_006604555.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] ref|XP_006604561.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] ref|XP_014627485.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] ref|XP_014627486.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] ref|XP_014627487.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] ref|XP_014627488.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] ref|XP_014627489.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] ref|XP_014627490.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] gb|KRG95931.1| hypothetical protein GLYMA_19G178900 [Glycine max] gb|KRG95932.1| hypothetical protein GLYMA_19G178900 [Glycine max] gb|KRG95933.1| hypothetical protein GLYMA_19G178900 [Glycine max] gb|KRG95934.1| hypothetical protein GLYMA_19G178900 [Glycine max] gb|KRG95935.1| hypothetical protein GLYMA_19G178900 [Glycine max] gb|KRG95936.1| hypothetical protein GLYMA_19G178900 [Glycine max] gb|KRG95937.1| hypothetical protein GLYMA_19G178900 [Glycine max] gb|KRG95938.1| hypothetical protein GLYMA_19G178900 [Glycine max] gb|KRG95939.1| hypothetical protein GLYMA_19G178900 [Glycine max] Length = 623 Score = 65.5 bits (158), Expect = 4e-09 Identities = 40/72 (55%), Positives = 45/72 (62%) Frame = -3 Query: 218 MQTPKAKARASASEVPQKKSPSSTPRTARQLKIXXXXXXXXXXXXNPTRKTPTDRSPNVV 39 MQTPKA R SEVPQKKSP+ TPRTA QLK +KT DRSP ++ Sbjct: 1 MQTPKA--RVGMSEVPQKKSPA-TPRTAHQLKTPNSDADSVSSPNA-AKKTSKDRSPKII 56 Query: 38 ERRSSYSPISEK 3 ERRS +SPISEK Sbjct: 57 ERRSPHSPISEK 68