BLASTX nr result
ID: Astragalus24_contig00026001
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00026001 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP30742.1| hypothetical protein JCGZ_15171 [Jatropha curcas]... 64 3e-10 gb|KYP74819.1| Lectin-domain containing receptor kinase A4.2 [Ca... 65 1e-09 ref|XP_020232203.1| LOW QUALITY PROTEIN: L-type lectin-domain co... 65 1e-09 ref|XP_007143518.1| hypothetical protein PHAVU_007G078200g [Phas... 63 6e-09 ref|XP_019442083.1| PREDICTED: L-type lectin-domain containing r... 63 6e-09 ref|XP_016176895.1| L-type lectin-domain containing receptor kin... 63 9e-09 ref|XP_020987171.1| L-type lectin-domain containing receptor kin... 63 9e-09 ref|XP_017413162.1| PREDICTED: L-type lectin-domain containing r... 62 1e-08 ref|XP_004496496.1| PREDICTED: L-type lectin-domain containing r... 61 3e-08 ref|XP_022640783.1| L-type lectin-domain containing receptor kin... 61 4e-08 ref|XP_003592149.1| lectin receptor kinase [Medicago truncatula]... 60 7e-08 gb|PNX86869.1| L-type lectin-domain containing receptor kinase S... 57 9e-08 gb|KHN16996.1| L-type lectin-domain containing receptor kinase S... 60 1e-07 ref|XP_006590203.1| PREDICTED: L-type lectin-domain containing r... 60 1e-07 gb|KRH35180.1| hypothetical protein GLYMA_10G227000 [Glycine max] 60 1e-07 dbj|GAU32309.1| hypothetical protein TSUD_43500 [Trifolium subte... 59 2e-07 gb|PNX83554.1| L-type lectin-domain containing receptor kinase S... 59 3e-07 gb|OAO92952.1| hypothetical protein AXX17_AT5G39930 [Arabidopsis... 58 5e-07 ref|NP_199027.1| Concanavalin A-like lectin protein kinase famil... 58 5e-07 ref|XP_010482025.1| PREDICTED: L-type lectin-domain containing r... 56 2e-06 >gb|KDP30742.1| hypothetical protein JCGZ_15171 [Jatropha curcas] gb|KDP30743.1| hypothetical protein JCGZ_15172 [Jatropha curcas] Length = 160 Score = 64.3 bits (155), Expect = 3e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +2 Query: 116 KVDALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 K DALEM RMLM+GLLCVHPD EKRPRVRDAARIL Sbjct: 74 KFDALEMGRMLMLGLLCVHPDYEKRPRVRDAARIL 108 >gb|KYP74819.1| Lectin-domain containing receptor kinase A4.2 [Cajanus cajan] Length = 644 Score = 65.5 bits (158), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 116 KVDALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 K DALEMERML+VGLLCVHPD EKRPRVR+AARIL Sbjct: 557 KFDALEMERMLLVGLLCVHPDYEKRPRVREAARIL 591 >ref|XP_020232203.1| LOW QUALITY PROTEIN: L-type lectin-domain containing receptor kinase S.6 [Cajanus cajan] Length = 654 Score = 65.5 bits (158), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 116 KVDALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 K DALEMERML+VGLLCVHPD EKRPRVR+AARIL Sbjct: 567 KFDALEMERMLLVGLLCVHPDYEKRPRVREAARIL 601 >ref|XP_007143518.1| hypothetical protein PHAVU_007G078200g [Phaseolus vulgaris] gb|ESW15512.1| hypothetical protein PHAVU_007G078200g [Phaseolus vulgaris] Length = 678 Score = 63.2 bits (152), Expect = 6e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 116 KVDALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 K DAL+MERML+VGLLCVHPD KRPRVR+AARIL Sbjct: 592 KFDALDMERMLLVGLLCVHPDDHKRPRVREAARIL 626 >ref|XP_019442083.1| PREDICTED: L-type lectin-domain containing receptor kinase S.6 [Lupinus angustifolius] Length = 705 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +2 Query: 116 KVDALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 K D LEMERML+VGLLCVHPD EKRP VRDAARIL Sbjct: 619 KFDVLEMERMLLVGLLCVHPDYEKRPTVRDAARIL 653 >ref|XP_016176895.1| L-type lectin-domain containing receptor kinase S.6 [Arachis ipaensis] Length = 701 Score = 62.8 bits (151), Expect = 9e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 122 DALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 D LEMERML+VGL+CVHPD EKRPRVRDAARIL Sbjct: 616 DVLEMERMLLVGLVCVHPDYEKRPRVRDAARIL 648 >ref|XP_020987171.1| L-type lectin-domain containing receptor kinase S.6 [Arachis duranensis] Length = 703 Score = 62.8 bits (151), Expect = 9e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 122 DALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 D LEMERML+VGL+CVHPD EKRPRVRDAARIL Sbjct: 618 DVLEMERMLLVGLVCVHPDYEKRPRVRDAARIL 650 >ref|XP_017413162.1| PREDICTED: L-type lectin-domain containing receptor kinase S.6 [Vigna angularis] Length = 670 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +2 Query: 116 KVDALEMERMLMVGLLCVHPDSEKRPRVRDAARILN 223 K DA++MERML+VGLLCVHPD EKRP VR+AAR+LN Sbjct: 588 KFDAVDMERMLLVGLLCVHPDHEKRPTVREAARMLN 623 >ref|XP_004496496.1| PREDICTED: L-type lectin-domain containing receptor kinase S.6 [Cicer arietinum] Length = 679 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +2 Query: 116 KVDALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 K D +EMERML+VGL+CVHPD EKRPRVRDAAR++ Sbjct: 593 KFDVVEMERMLLVGLVCVHPDYEKRPRVRDAARMI 627 >ref|XP_022640783.1| L-type lectin-domain containing receptor kinase S.6 [Vigna radiata var. radiata] Length = 670 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +2 Query: 116 KVDALEMERMLMVGLLCVHPDSEKRPRVRDAARILN 223 K DA++MERML+VGLLCVHPD KRP VR+AAR+LN Sbjct: 588 KYDAVDMERMLLVGLLCVHPDQSKRPTVREAARMLN 623 >ref|XP_003592149.1| lectin receptor kinase [Medicago truncatula] gb|AES62400.1| lectin receptor kinase [Medicago truncatula] Length = 666 Score = 60.1 bits (144), Expect = 7e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 122 DALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 D +EMERML+VGL+CVHPD EKRPRVRDAAR++ Sbjct: 582 DVIEMERMLLVGLVCVHPDYEKRPRVRDAARMI 614 >gb|PNX86869.1| L-type lectin-domain containing receptor kinase S.6-like protein, partial [Trifolium pratense] Length = 122 Score = 57.0 bits (136), Expect = 9e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 122 DALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 + ++MERML+VGL+CVHPD EKRPRVRDAAR++ Sbjct: 71 NVIQMERMLLVGLVCVHPDYEKRPRVRDAARMI 103 >gb|KHN16996.1| L-type lectin-domain containing receptor kinase S.6 [Glycine soja] Length = 499 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 116 KVDALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 K D EMERML+VGLLCVHPD EKRPRVR+A RIL Sbjct: 412 KFDEKEMERMLLVGLLCVHPDYEKRPRVREATRIL 446 >ref|XP_006590203.1| PREDICTED: L-type lectin-domain containing receptor kinase S.6 [Glycine max] Length = 663 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 116 KVDALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 K D EMERML+VGLLCVHPD EKRPRVR+A RIL Sbjct: 576 KFDEKEMERMLLVGLLCVHPDYEKRPRVREATRIL 610 >gb|KRH35180.1| hypothetical protein GLYMA_10G227000 [Glycine max] Length = 685 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 116 KVDALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 K D EMERML+VGLLCVHPD EKRPRVR+A RIL Sbjct: 598 KFDEKEMERMLLVGLLCVHPDYEKRPRVREATRIL 632 >dbj|GAU32309.1| hypothetical protein TSUD_43500 [Trifolium subterraneum] Length = 506 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +2 Query: 122 DALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 D +EMERML+VGL+CVHPD EKRPRV+DAAR++ Sbjct: 422 DVIEMERMLLVGLVCVHPDYEKRPRVKDAARMI 454 >gb|PNX83554.1| L-type lectin-domain containing receptor kinase S.6-like protein [Trifolium pratense] Length = 559 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +2 Query: 122 DALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 D +EMERML+VGL+CVHPD EKRPRVR+AAR++ Sbjct: 475 DVIEMERMLLVGLVCVHPDYEKRPRVREAARMI 507 >gb|OAO92952.1| hypothetical protein AXX17_AT5G39930 [Arabidopsis thaliana] Length = 691 Score = 57.8 bits (138), Expect = 5e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 122 DALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 DA EMER+LMVG++C HPDSEKRPRV+DA RI+ Sbjct: 612 DAEEMERVLMVGMVCAHPDSEKRPRVKDAVRII 644 >ref|NP_199027.1| Concanavalin A-like lectin protein kinase family protein [Arabidopsis thaliana] sp|Q9FHX3.1|LRKS6_ARATH RecName: Full=L-type lectin-domain containing receptor kinase S.6; Short=LecRK-S.6; Flags: Precursor dbj|BAB08445.1| receptor lectin kinase-like protein [Arabidopsis thaliana] gb|ABE66214.1| lectin protein kinase family protein [Arabidopsis thaliana] gb|AED94770.1| Concanavalin A-like lectin protein kinase family protein [Arabidopsis thaliana] Length = 691 Score = 57.8 bits (138), Expect = 5e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 122 DALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 DA EMER+LMVG++C HPDSEKRPRV+DA RI+ Sbjct: 612 DAEEMERVLMVGMVCAHPDSEKRPRVKDAVRII 644 >ref|XP_010482025.1| PREDICTED: L-type lectin-domain containing receptor kinase S.6-like [Camelina sativa] Length = 688 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 122 DALEMERMLMVGLLCVHPDSEKRPRVRDAARIL 220 DA EMER+LMVG++C HPDSEKRPRV++A RI+ Sbjct: 609 DAEEMERVLMVGMVCAHPDSEKRPRVKEAVRII 641