BLASTX nr result
ID: Astragalus24_contig00025864
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00025864 (344 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012567512.1| PREDICTED: uncharacterized protein LOC105851... 55 3e-06 ref|XP_012574210.1| PREDICTED: uncharacterized protein LOC105852... 53 6e-06 >ref|XP_012567512.1| PREDICTED: uncharacterized protein LOC105851333 [Cicer arietinum] Length = 348 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 240 SHVMTLIQNRFSGEDVDDILQVARQAPTASSAP 338 +++MTLIQNRFSGEDV+DI+Q ARQ P ASSAP Sbjct: 297 ANIMTLIQNRFSGEDVNDIIQAARQIPDASSAP 329 >ref|XP_012574210.1| PREDICTED: uncharacterized protein LOC105852606 [Cicer arietinum] Length = 183 Score = 52.8 bits (125), Expect = 6e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 240 SHVMTLIQNRFSGEDVDDILQVARQAPTASSA 335 ++VMTLIQNRFSGEDV+DI+Q ARQ P ASSA Sbjct: 124 ANVMTLIQNRFSGEDVNDIIQAARQVPDASSA 155