BLASTX nr result
ID: Astragalus24_contig00025677
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00025677 (662 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019447989.1| PREDICTED: uncharacterized protein LOC109351... 57 7e-06 >ref|XP_019447989.1| PREDICTED: uncharacterized protein LOC109351097 [Lupinus angustifolius] gb|OIW09204.1| hypothetical protein TanjilG_11342 [Lupinus angustifolius] Length = 497 Score = 57.0 bits (136), Expect = 7e-06 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = -1 Query: 119 ALDLILPFSDLARFWMNTNDGYEALFPPVRSDVFGWIC 6 +L+LI PF+DLAR W+N+NDG+E+L P V S+V+ W+C Sbjct: 163 SLNLISPFADLARVWVNSNDGFESLLPLVSSEVYSWLC 200