BLASTX nr result
ID: Astragalus24_contig00025576
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00025576 (499 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU13382.1| hypothetical protein TSUD_126780 [Trifolium subt... 67 9e-10 gb|PNX81485.1| zinc finger family protein [Trifolium pratense] 62 5e-08 ref|XP_004500239.1| PREDICTED: uncharacterized protein LOC101489... 58 8e-07 ref|XP_013460192.1| C2H2-like zinc finger protein [Medicago trun... 57 2e-06 >dbj|GAU13382.1| hypothetical protein TSUD_126780 [Trifolium subterraneum] Length = 391 Score = 66.6 bits (161), Expect = 9e-10 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 3/69 (4%) Frame = -1 Query: 499 TQKALSSSWHFIKHLFSTKFCKTA---NXXXXXXXXXXXXXXXXXXXSEQLLTPLSQPDP 329 T KA+SSSWHFIKHLFST CKTA S+Q L L QPDP Sbjct: 66 THKAISSSWHFIKHLFSTNSCKTAITTTQSSPQSTSTSTITSTTAKSSQQSLISLVQPDP 125 Query: 328 NFSDPPRKK 302 NFSDPPRKK Sbjct: 126 NFSDPPRKK 134 >gb|PNX81485.1| zinc finger family protein [Trifolium pratense] Length = 392 Score = 61.6 bits (148), Expect = 5e-08 Identities = 35/70 (50%), Positives = 37/70 (52%), Gaps = 4/70 (5%) Frame = -1 Query: 499 TQKALSSSWHFIKHLFSTKFCK----TANXXXXXXXXXXXXXXXXXXXSEQLLTPLSQPD 332 T KA+SSSWHFIKHLFST CK T S+Q L L Q D Sbjct: 66 THKAISSSWHFIKHLFSTNSCKAATATTTQSSPQSTSTSIITSTTAKSSQQSLISLVQTD 125 Query: 331 PNFSDPPRKK 302 PNFSDPPRKK Sbjct: 126 PNFSDPPRKK 135 >ref|XP_004500239.1| PREDICTED: uncharacterized protein LOC101489748 [Cicer arietinum] Length = 395 Score = 58.2 bits (139), Expect = 8e-07 Identities = 35/73 (47%), Positives = 37/73 (50%), Gaps = 7/73 (9%) Frame = -1 Query: 499 TQKALSSSWHFIKHLFSTKFCKTA-------NXXXXXXXXXXXXXXXXXXXSEQLLTPLS 341 T KALSSSWHFIKHLFSTK CKTA + S+Q L Sbjct: 65 TNKALSSSWHFIKHLFSTKSCKTATATSTTNSSPQSTSTVTAAATLTTARSSQQSLISSV 124 Query: 340 QPDPNFSDPPRKK 302 QPD NF D PRKK Sbjct: 125 QPDSNFQDSPRKK 137 >ref|XP_013460192.1| C2H2-like zinc finger protein [Medicago truncatula] gb|KEH34223.1| C2H2-like zinc finger protein [Medicago truncatula] Length = 389 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/66 (46%), Positives = 32/66 (48%) Frame = -1 Query: 499 TQKALSSSWHFIKHLFSTKFCKTANXXXXXXXXXXXXXXXXXXXSEQLLTPLSQPDPNFS 320 T K LSSSWHFIKHLF KT S Q L L QPDP+F Sbjct: 65 THKTLSSSWHFIKHLFCKNSSKTVTTTPTTQSSPQSTITNTVKASTQSLISLVQPDPSFQ 124 Query: 319 DPPRKK 302 DPPRKK Sbjct: 125 DPPRKK 130