BLASTX nr result
ID: Astragalus24_contig00025451
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00025451 (585 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH37191.1| hypothetical protein GLYMA_09G050500 [Glycine max] 85 8e-16 gb|KHN26609.1| Pentatricopeptide repeat-containing protein [Glyc... 85 9e-16 ref|XP_006586943.1| PREDICTED: pentatricopeptide repeat-containi... 85 1e-15 ref|XP_022636129.1| pentatricopeptide repeat-containing protein ... 81 3e-14 ref|XP_007138861.1| hypothetical protein PHAVU_009G243700g [Phas... 81 3e-14 ref|XP_017408274.1| PREDICTED: pentatricopeptide repeat-containi... 80 7e-14 ref|XP_012573735.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-13 gb|PNY07880.1| pentatricopeptide repeat-containing protein at4g2... 76 1e-12 ref|XP_020209906.1| pentatricopeptide repeat-containing protein ... 75 2e-12 dbj|GAU33588.1| hypothetical protein TSUD_359660 [Trifolium subt... 75 2e-12 dbj|GAU43169.1| hypothetical protein TSUD_301340 [Trifolium subt... 74 5e-12 dbj|GAU43168.1| hypothetical protein TSUD_301350 [Trifolium subt... 74 5e-12 gb|OIW14265.1| hypothetical protein TanjilG_21405 [Lupinus angus... 73 1e-11 ref|XP_019439321.1| PREDICTED: pentatricopeptide repeat-containi... 73 1e-11 ref|XP_020965463.1| pentatricopeptide repeat-containing protein ... 72 3e-11 ref|XP_016171182.1| pentatricopeptide repeat-containing protein ... 72 3e-11 ref|XP_015937071.1| pentatricopeptide repeat-containing protein ... 72 3e-11 ref|XP_018853395.1| PREDICTED: pentatricopeptide repeat-containi... 72 4e-11 ref|XP_003594857.1| PPR containing plant-like protein [Medicago ... 71 6e-11 ref|XP_022879144.1| pentatricopeptide repeat-containing protein ... 71 6e-11 >gb|KRH37191.1| hypothetical protein GLYMA_09G050500 [Glycine max] Length = 482 Score = 85.1 bits (209), Expect = 8e-16 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLCC 450 SKIIEVM+HKFL PKASTWA+VVQ +CKPKNVRKAISECWS+L C Sbjct: 438 SKIIEVMMHKFLLPKASTWAMVVQQVCKPKNVRKAISECWSRLSC 482 >gb|KHN26609.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 556 Score = 85.1 bits (209), Expect = 9e-16 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLCC 450 SKIIEVM+HKFL PKASTWA+VVQ +CKPKNVRKAISECWS+L C Sbjct: 512 SKIIEVMMHKFLLPKASTWAMVVQQVCKPKNVRKAISECWSRLSC 556 >ref|XP_006586943.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Glycine max] ref|XP_006586944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Glycine max] ref|XP_006586946.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Glycine max] ref|XP_014617398.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Glycine max] ref|XP_014617399.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Glycine max] gb|KRH37190.1| hypothetical protein GLYMA_09G050500 [Glycine max] Length = 642 Score = 85.1 bits (209), Expect = 1e-15 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLCC 450 SKIIEVM+HKFL PKASTWA+VVQ +CKPKNVRKAISECWS+L C Sbjct: 598 SKIIEVMMHKFLLPKASTWAMVVQQVCKPKNVRKAISECWSRLSC 642 >ref|XP_022636129.1| pentatricopeptide repeat-containing protein At4g20090-like [Vigna radiata var. radiata] Length = 645 Score = 80.9 bits (198), Expect = 3e-14 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -2 Query: 581 KIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLCC 450 +IIEVMLHKFL PKASTWA++VQ LCKPKN RK ISECWSKL C Sbjct: 602 RIIEVMLHKFLLPKASTWAMIVQQLCKPKNGRKVISECWSKLSC 645 >ref|XP_007138861.1| hypothetical protein PHAVU_009G243700g [Phaseolus vulgaris] gb|ESW10855.1| hypothetical protein PHAVU_009G243700g [Phaseolus vulgaris] Length = 645 Score = 80.9 bits (198), Expect = 3e-14 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKL 456 SKIIEVMLHKFL PKASTWA++VQ LCKPK VRK ISECWSKL Sbjct: 601 SKIIEVMLHKFLLPKASTWAMIVQQLCKPKRVRKVISECWSKL 643 >ref|XP_017408274.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Vigna angularis] ref|XP_017408275.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Vigna angularis] ref|XP_017408276.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Vigna angularis] gb|KOM27871.1| hypothetical protein LR48_Vigan468s003300 [Vigna angularis] dbj|BAT80211.1| hypothetical protein VIGAN_02320600 [Vigna angularis var. angularis] Length = 645 Score = 79.7 bits (195), Expect = 7e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKL 456 SKIIEVMLHKFL PKASTWA++V+ LCKPK+VRK ISECWSKL Sbjct: 601 SKIIEVMLHKFLLPKASTWAMIVKQLCKPKSVRKVISECWSKL 643 >ref|XP_012573735.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Cicer arietinum] Length = 649 Score = 78.2 bits (191), Expect = 2e-13 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLCC 450 S +IEVML KFL PKASTWALVVQ LCKP VRK I+ECWS+LCC Sbjct: 605 SNVIEVMLPKFLLPKASTWALVVQHLCKPMKVRKTINECWSRLCC 649 >gb|PNY07880.1| pentatricopeptide repeat-containing protein at4g20090-like protein [Trifolium pratense] Length = 557 Score = 75.9 bits (185), Expect = 1e-12 Identities = 34/45 (75%), Positives = 36/45 (80%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLCC 450 S IIEVML KFL PK STWAL VQ +CKP VRK ISECWS+LCC Sbjct: 513 SNIIEVMLKKFLLPKPSTWALAVQQICKPMKVRKTISECWSRLCC 557 >ref|XP_020209906.1| pentatricopeptide repeat-containing protein At4g20090, partial [Cajanus cajan] Length = 449 Score = 75.5 bits (184), Expect = 2e-12 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLCC 450 +KI+EVMLHKFL PK STWA+VVQ LCKPK ++K I+ECWS+L C Sbjct: 405 TKIVEVMLHKFLIPKVSTWAMVVQQLCKPKIIQKTINECWSRLSC 449 >dbj|GAU33588.1| hypothetical protein TSUD_359660 [Trifolium subterraneum] Length = 645 Score = 75.5 bits (184), Expect = 2e-12 Identities = 34/45 (75%), Positives = 36/45 (80%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLCC 450 S IIEVML KFL PK STWAL VQ LCKP VRK ISECW++LCC Sbjct: 601 SNIIEVMLKKFLLPKPSTWALAVQQLCKPMKVRKTISECWTRLCC 645 >dbj|GAU43169.1| hypothetical protein TSUD_301340 [Trifolium subterraneum] Length = 469 Score = 74.3 bits (181), Expect = 5e-12 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLCC 450 S IIEVML KFL PK STWAL Q LCKP VRK ISECWS++CC Sbjct: 425 SNIIEVMLKKFLLPKPSTWALAAQQLCKPTKVRKTISECWSRMCC 469 >dbj|GAU43168.1| hypothetical protein TSUD_301350 [Trifolium subterraneum] Length = 761 Score = 74.3 bits (181), Expect = 5e-12 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLCC 450 S IIEVML KFL PK STWAL Q LCKP VRK ISECWS++CC Sbjct: 717 SNIIEVMLKKFLLPKPSTWALAAQQLCKPTKVRKTISECWSRMCC 761 >gb|OIW14265.1| hypothetical protein TanjilG_21405 [Lupinus angustifolius] Length = 594 Score = 73.2 bits (178), Expect = 1e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKL 456 SKIIEVMLHKFL PKASTWA+VVQ L KPK +R AI+ECWS+L Sbjct: 550 SKIIEVMLHKFLLPKASTWAIVVQQLYKPKKIRLAINECWSRL 592 >ref|XP_019439321.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Lupinus angustifolius] ref|XP_019439322.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090 isoform X2 [Lupinus angustifolius] Length = 651 Score = 73.2 bits (178), Expect = 1e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKL 456 SKIIEVMLHKFL PKASTWA+VVQ L KPK +R AI+ECWS+L Sbjct: 607 SKIIEVMLHKFLLPKASTWAIVVQQLYKPKKIRLAINECWSRL 649 >ref|XP_020965463.1| pentatricopeptide repeat-containing protein At4g20090 isoform X2 [Arachis ipaensis] Length = 558 Score = 72.0 bits (175), Expect = 3e-11 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLC 453 SK IEVML KFL PK STWA VV+ LCKPK VR+ I ECWSKLC Sbjct: 514 SKTIEVMLQKFLLPKGSTWATVVKHLCKPKKVRETIRECWSKLC 557 >ref|XP_016171182.1| pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Arachis ipaensis] ref|XP_016171183.1| pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Arachis ipaensis] ref|XP_016171184.1| pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Arachis ipaensis] ref|XP_020965459.1| pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Arachis ipaensis] ref|XP_020965460.1| pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Arachis ipaensis] ref|XP_020965461.1| pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Arachis ipaensis] ref|XP_020965462.1| pentatricopeptide repeat-containing protein At4g20090 isoform X1 [Arachis ipaensis] Length = 661 Score = 72.0 bits (175), Expect = 3e-11 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLC 453 SK IEVML KFL PK STWA VV+ LCKPK VR+ I ECWSKLC Sbjct: 617 SKTIEVMLQKFLLPKGSTWATVVKHLCKPKKVRETIRECWSKLC 660 >ref|XP_015937071.1| pentatricopeptide repeat-containing protein At4g20090 [Arachis duranensis] Length = 661 Score = 72.0 bits (175), Expect = 3e-11 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLC 453 SK IEVML KFL PK STWA VV+ LCKPK VR+ I ECWSKLC Sbjct: 617 SKTIEVMLQKFLLPKGSTWATVVKHLCKPKKVRETIRECWSKLC 660 >ref|XP_018853395.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090 [Juglans regia] Length = 665 Score = 71.6 bits (174), Expect = 4e-11 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLCC 450 SKI+EVML KFL PKASTWA VVQ LCKPK ++ AI +CWS L C Sbjct: 621 SKIVEVMLQKFLPPKASTWARVVQELCKPKKIQAAIDKCWSSLYC 665 >ref|XP_003594857.1| PPR containing plant-like protein [Medicago truncatula] gb|AES65108.1| PPR containing plant-like protein [Medicago truncatula] Length = 647 Score = 71.2 bits (173), Expect = 6e-11 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKLCC 450 S IIEVML KFL PK STWAL VQ LCKP VRK ISEC S++CC Sbjct: 603 SNIIEVMLQKFLLPKPSTWALAVQQLCKPMKVRKTISECQSRMCC 647 >ref|XP_022879144.1| pentatricopeptide repeat-containing protein At4g20090 [Olea europaea var. sylvestris] Length = 671 Score = 71.2 bits (173), Expect = 6e-11 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -2 Query: 584 SKIIEVMLHKFLQPKASTWALVVQGLCKPKNVRKAISECWSKL 456 SKIIEVMLHKFLQPKASTW V++G CKPK ++ AI CW++L Sbjct: 628 SKIIEVMLHKFLQPKASTWEKVIRGFCKPKKIQTAIDNCWNEL 670