BLASTX nr result
ID: Astragalus24_contig00025402
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00025402 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH37229.1| hypothetical protein GLYMA_09G053100 [Glycine max] 67 2e-12 >gb|KRH37229.1| hypothetical protein GLYMA_09G053100 [Glycine max] Length = 46 Score = 67.4 bits (163), Expect = 2e-12 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -2 Query: 426 SKKPNIQKALCPTKPPPDQNNNSSTSNSGVKKPPSAKDMFYPKNK 292 SK NIQKALCPTKPPP ++ S++S+SG KKPPS KD+FYPKN+ Sbjct: 3 SKDTNIQKALCPTKPPP-KSTGSTSSSSGGKKPPSTKDIFYPKNR 46