BLASTX nr result
ID: Astragalus24_contig00025169
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00025169 (337 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003614142.2| fatty acyl-CoA reductase [Medicago truncatul... 57 3e-07 ref|XP_003606214.2| gland-specific fatty acyl-CoA reductase [Med... 57 6e-07 ref|XP_003606187.1| fatty acyl-CoA reductase [Medicago truncatul... 56 1e-06 ref|XP_003615808.2| gland-specific fatty acyl-CoA reductase [Med... 54 6e-06 ref|XP_019239633.1| PREDICTED: fatty acyl-CoA reductase 1-like [... 52 9e-06 >ref|XP_003614142.2| fatty acyl-CoA reductase [Medicago truncatula] gb|AES97100.2| fatty acyl-CoA reductase [Medicago truncatula] Length = 478 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +2 Query: 2 DVAVENLGLRNEHIKNVLFGEIDIIVNFAATTKFDERY 115 DVAVENLG+++++I NV+F EID+IVN AATT FDER+ Sbjct: 93 DVAVENLGIKDQNILNVMFEEIDLIVNSAATTNFDERF 130 >ref|XP_003606214.2| gland-specific fatty acyl-CoA reductase [Medicago truncatula] gb|AES88411.2| gland-specific fatty acyl-CoA reductase [Medicago truncatula] Length = 494 Score = 56.6 bits (135), Expect = 6e-07 Identities = 25/47 (53%), Positives = 38/47 (80%) Frame = +2 Query: 2 DVAVENLGLRNEHIKNVLFGEIDIIVNFAATTKFDERYIGLTSVRNE 142 DVA+ENLG+++E +K +F EID++V+FAA+TKFDER+ L +V + Sbjct: 90 DVAIENLGIKDEKLKREIFEEIDLLVHFAASTKFDERFDILMAVNTQ 136 >ref|XP_003606187.1| fatty acyl-CoA reductase [Medicago truncatula] gb|AES88384.1| fatty acyl-CoA reductase [Medicago truncatula] Length = 296 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/38 (63%), Positives = 35/38 (92%) Frame = +2 Query: 2 DVAVENLGLRNEHIKNVLFGEIDIIVNFAATTKFDERY 115 DVAVENLG+++++I N +F EID++V+FAA+TKFDER+ Sbjct: 90 DVAVENLGIKDQNILNEIFEEIDLLVHFAASTKFDERF 127 >ref|XP_003615808.2| gland-specific fatty acyl-CoA reductase [Medicago truncatula] gb|AES98766.2| gland-specific fatty acyl-CoA reductase [Medicago truncatula] Length = 492 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +2 Query: 2 DVAVENLGLRNEHIKNVLFGEIDIIVNFAATTKFDERY 115 DV+V+NLGL++E++ LF EID+IVNFAATTKFDER+ Sbjct: 93 DVSVQNLGLKDENLN--LFQEIDLIVNFAATTKFDERF 128 >ref|XP_019239633.1| PREDICTED: fatty acyl-CoA reductase 1-like [Nicotiana attenuata] Length = 140 Score = 51.6 bits (122), Expect = 9e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +2 Query: 2 DVAVENLGLRNEHIKNVLFGEIDIIVNFAATTKFDERY 115 D++ E+ G+ N IK+ +F EIDII+N AATT+FDERY Sbjct: 94 DISFEDFGIENSEIKDEMFKEIDIIINSAATTRFDERY 131