BLASTX nr result
ID: Astragalus24_contig00025165
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00025165 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594555.1| PPR containing plant-like protein [Medicago ... 75 7e-13 ref|XP_004486474.1| PREDICTED: pentatricopeptide repeat-containi... 75 7e-13 gb|KYP52014.1| hypothetical protein KK1_026091 [Cajanus cajan] 74 2e-12 ref|XP_020230767.1| pentatricopeptide repeat-containing protein ... 74 2e-12 gb|PNY11850.1| pentatricopeptide repeat-containing protein mitoc... 73 3e-12 ref|XP_019425542.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-12 ref|XP_006597666.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-12 ref|XP_016195055.1| pentatricopeptide repeat-containing protein ... 71 7e-12 dbj|GAU12504.1| hypothetical protein TSUD_377550 [Trifolium subt... 72 1e-11 ref|XP_021654668.1| pentatricopeptide repeat-containing protein ... 72 1e-11 gb|KOM53148.1| hypothetical protein LR48_Vigan09g180700 [Vigna a... 72 1e-11 ref|XP_017433996.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-11 ref|XP_014517084.1| pentatricopeptide repeat-containing protein ... 72 2e-11 ref|XP_007147463.1| hypothetical protein PHAVU_006G126800g [Phas... 72 2e-11 ref|XP_010098161.1| pentatricopeptide repeat-containing protein ... 71 3e-11 gb|EEF46368.1| pentatricopeptide repeat-containing protein, puta... 70 4e-11 gb|KDP40844.1| hypothetical protein JCGZ_24843 [Jatropha curcas] 70 6e-11 ref|XP_020995688.1| pentatricopeptide repeat-containing protein ... 70 7e-11 ref|XP_021628750.1| pentatricopeptide repeat-containing protein ... 70 7e-11 ref|XP_012069061.1| pentatricopeptide repeat-containing protein ... 70 7e-11 >ref|XP_003594555.1| PPR containing plant-like protein [Medicago truncatula] gb|AES64806.1| PPR containing plant-like protein [Medicago truncatula] Length = 639 Score = 75.5 bits (184), Expect = 7e-13 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITYAVLERLQSGRHGKL++RRQNPITGW+VSPL+ Sbjct: 603 PDSITYAVLERLQSGRHGKLRVRRQNPITGWVVSPLQ 639 >ref|XP_004486474.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Cicer arietinum] Length = 664 Score = 75.5 bits (184), Expect = 7e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPL 109 PDSITYAVLERLQSGRHGKL+IRRQNPITGW+VSPL Sbjct: 629 PDSITYAVLERLQSGRHGKLRIRRQNPITGWVVSPL 664 >gb|KYP52014.1| hypothetical protein KK1_026091 [Cajanus cajan] Length = 469 Score = 74.3 bits (181), Expect = 2e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITYAVLERLQSG HGKLK RRQNPITGW+VSPLR Sbjct: 433 PDSITYAVLERLQSGGHGKLKFRRQNPITGWVVSPLR 469 >ref|XP_020230767.1| pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Cajanus cajan] Length = 647 Score = 74.3 bits (181), Expect = 2e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITYAVLERLQSG HGKLK RRQNPITGW+VSPLR Sbjct: 611 PDSITYAVLERLQSGGHGKLKFRRQNPITGWVVSPLR 647 >gb|PNY11850.1| pentatricopeptide repeat-containing protein mitochondrial-like [Trifolium pratense] Length = 363 Score = 73.2 bits (178), Expect = 3e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPL 109 PDSITYAVLERLQSGRHGKL+ RRQNPITGW+VSPL Sbjct: 328 PDSITYAVLERLQSGRHGKLRSRRQNPITGWVVSPL 363 >ref|XP_019425542.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Lupinus angustifolius] gb|OIV91809.1| hypothetical protein TanjilG_14388 [Lupinus angustifolius] Length = 644 Score = 73.6 bits (179), Expect = 3e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITYAVLERLQSG HGKL+ RRQNPITGWIVSPLR Sbjct: 608 PDSITYAVLERLQSGGHGKLRFRRQNPITGWIVSPLR 644 >ref|XP_006597666.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Glycine max] gb|KRH11807.1| hypothetical protein GLYMA_15G131800 [Glycine max] Length = 648 Score = 73.2 bits (178), Expect = 5e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITYAVLERLQSG HGKL+ RRQNPITGW+VSPLR Sbjct: 612 PDSITYAVLERLQSGGHGKLRFRRQNPITGWVVSPLR 648 >ref|XP_016195055.1| pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like [Arachis ipaensis] Length = 233 Score = 70.9 bits (172), Expect = 7e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITYAVLERLQSG H KL+ RRQNPITGW+VSPLR Sbjct: 197 PDSITYAVLERLQSGGHNKLRFRRQNPITGWVVSPLR 233 >dbj|GAU12504.1| hypothetical protein TSUD_377550 [Trifolium subterraneum] Length = 647 Score = 72.0 bits (175), Expect = 1e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPL 109 PDSITYAVLERLQSGRHGKL+ R+QNPITGW+VSPL Sbjct: 612 PDSITYAVLERLQSGRHGKLRSRKQNPITGWVVSPL 647 >ref|XP_021654668.1| pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Hevea brasiliensis] Length = 664 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITY+VLERLQSG HGK+++RRQNPITGW+VSPLR Sbjct: 628 PDSITYSVLERLQSGSHGKVRLRRQNPITGWVVSPLR 664 >gb|KOM53148.1| hypothetical protein LR48_Vigan09g180700 [Vigna angularis] Length = 391 Score = 71.6 bits (174), Expect = 1e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITY VLERLQSG HGKL+ RRQNPITGW+VSPLR Sbjct: 355 PDSITYTVLERLQSGGHGKLRFRRQNPITGWVVSPLR 391 >ref|XP_017433996.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Vigna angularis] dbj|BAT87695.1| hypothetical protein VIGAN_05108900 [Vigna angularis var. angularis] Length = 646 Score = 71.6 bits (174), Expect = 2e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITY VLERLQSG HGKL+ RRQNPITGW+VSPLR Sbjct: 610 PDSITYTVLERLQSGGHGKLRFRRQNPITGWVVSPLR 646 >ref|XP_014517084.1| pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Vigna radiata var. radiata] Length = 646 Score = 71.6 bits (174), Expect = 2e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITY VLERLQSG HGKL+ RRQNPITGW+VSPLR Sbjct: 610 PDSITYTVLERLQSGGHGKLRFRRQNPITGWVVSPLR 646 >ref|XP_007147463.1| hypothetical protein PHAVU_006G126800g [Phaseolus vulgaris] gb|ESW19457.1| hypothetical protein PHAVU_006G126800g [Phaseolus vulgaris] Length = 646 Score = 71.6 bits (174), Expect = 2e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITY VLERLQSG HGKL+ RRQNPITGW+VSPLR Sbjct: 610 PDSITYTVLERLQSGGHGKLRFRRQNPITGWVVSPLR 646 >ref|XP_010098161.1| pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Morus notabilis] gb|EXB74598.1| hypothetical protein L484_026295 [Morus notabilis] Length = 656 Score = 70.9 bits (172), Expect = 3e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITYAVLERLQSG HGK ++RRQ+PITGW+VSPLR Sbjct: 620 PDSITYAVLERLQSGSHGKTRVRRQSPITGWVVSPLR 656 >gb|EEF46368.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 706 Score = 70.5 bits (171), Expect = 4e-11 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR*YRKTKTIDI 142 PDSITY+VLERLQSG H KL++RR+NPITGW+VSPLR + K DI Sbjct: 457 PDSITYSVLERLQSGSHRKLRVRRKNPITGWVVSPLRYFLKQLQGDI 503 >gb|KDP40844.1| hypothetical protein JCGZ_24843 [Jatropha curcas] Length = 391 Score = 69.7 bits (169), Expect = 6e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITY+VLERLQSG H K++IRRQNPITGW+VSPLR Sbjct: 355 PDSITYSVLERLQSGSHRKVRIRRQNPITGWVVSPLR 391 >ref|XP_020995688.1| pentatricopeptide repeat-containing protein At1g51965, mitochondrial isoform X2 [Arachis duranensis] Length = 640 Score = 69.7 bits (169), Expect = 7e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITYAVLERLQSG H +L+ RRQNPITGW+VSPLR Sbjct: 604 PDSITYAVLERLQSGGHNRLRFRRQNPITGWVVSPLR 640 >ref|XP_021628750.1| pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Manihot esculenta] Length = 664 Score = 69.7 bits (169), Expect = 7e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITY+VLERLQSG H K+++RRQNPITGW+VSPLR Sbjct: 628 PDSITYSVLERLQSGSHAKVRLRRQNPITGWVVSPLR 664 >ref|XP_012069061.1| pentatricopeptide repeat-containing protein At1g51965, mitochondrial isoform X1 [Jatropha curcas] ref|XP_020534039.1| pentatricopeptide repeat-containing protein At1g51965, mitochondrial isoform X2 [Jatropha curcas] Length = 664 Score = 69.7 bits (169), Expect = 7e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 2 PDSITYAVLERLQSGRHGKLKIRRQNPITGWIVSPLR 112 PDSITY+VLERLQSG H K++IRRQNPITGW+VSPLR Sbjct: 628 PDSITYSVLERLQSGSHRKVRIRRQNPITGWVVSPLR 664