BLASTX nr result
ID: Astragalus24_contig00025008
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00025008 (306 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020210320.1| pentatricopeptide repeat-containing protein ... 47 5e-07 gb|KYP73902.1| Putative pentatricopeptide repeat-containing prot... 47 5e-07 gb|KHN42800.1| Pentatricopeptide repeat-containing protein, chlo... 47 1e-06 ref|XP_006575303.1| PREDICTED: pentatricopeptide repeat-containi... 47 1e-06 gb|PNY14599.1| pentatricopeptide repeat-containing protein at1g0... 47 2e-06 ref|XP_013467967.1| organelle transcript processing protein, put... 48 4e-06 ref|XP_004515218.1| PREDICTED: pentatricopeptide repeat-containi... 49 4e-06 ref|XP_004515217.1| PREDICTED: pentatricopeptide repeat-containi... 49 4e-06 >ref|XP_020210320.1| pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Cajanus cajan] Length = 573 Score = 47.4 bits (111), Expect(2) = 5e-07 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +2 Query: 86 VVLKYGLLLDHFVCASFVHMYAKFMVIEN 172 VVLK+GL LDHFVCAS V MYAK MV+E+ Sbjct: 126 VVLKHGLHLDHFVCASLVDMYAKCMVVED 154 Score = 33.9 bits (76), Expect(2) = 5e-07 Identities = 17/26 (65%), Positives = 18/26 (69%), Gaps = 6/26 (23%) Frame = +1 Query: 1 LRCGVTPGNYTLPF------DYKNLQ 60 LRCGVTP NYTLPF D K+LQ Sbjct: 93 LRCGVTPDNYTLPFVIRTSRDTKDLQ 118 >gb|KYP73902.1| Putative pentatricopeptide repeat-containing protein At3g23330 family [Cajanus cajan] Length = 511 Score = 47.4 bits (111), Expect(2) = 5e-07 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +2 Query: 86 VVLKYGLLLDHFVCASFVHMYAKFMVIEN 172 VVLK+GL LDHFVCAS V MYAK MV+E+ Sbjct: 64 VVLKHGLHLDHFVCASLVDMYAKCMVVED 92 Score = 33.9 bits (76), Expect(2) = 5e-07 Identities = 17/26 (65%), Positives = 18/26 (69%), Gaps = 6/26 (23%) Frame = +1 Query: 1 LRCGVTPGNYTLPF------DYKNLQ 60 LRCGVTP NYTLPF D K+LQ Sbjct: 31 LRCGVTPDNYTLPFVIRTSRDTKDLQ 56 >gb|KHN42800.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 573 Score = 46.6 bits (109), Expect(2) = 1e-06 Identities = 25/48 (52%), Positives = 31/48 (64%), Gaps = 5/48 (10%) Frame = +2 Query: 44 IIRICKDHFVTPTC-----VVLKYGLLLDHFVCASFVHMYAKFMVIEN 172 +IR C+D VVLK+GLL DHFVCAS V MYAK +V+E+ Sbjct: 107 VIRTCRDRTDLQIGRVIHDVVLKHGLLSDHFVCASLVDMYAKCIVVED 154 Score = 33.1 bits (74), Expect(2) = 1e-06 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +1 Query: 1 LRCGVTPGNYTLPF 42 LRCGVTP NYTLPF Sbjct: 93 LRCGVTPDNYTLPF 106 >ref|XP_006575303.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Glycine max] gb|KRH72271.1| hypothetical protein GLYMA_02G201800 [Glycine max] Length = 573 Score = 46.6 bits (109), Expect(2) = 1e-06 Identities = 25/48 (52%), Positives = 31/48 (64%), Gaps = 5/48 (10%) Frame = +2 Query: 44 IIRICKDHFVTPTC-----VVLKYGLLLDHFVCASFVHMYAKFMVIEN 172 +IR C+D VVLK+GLL DHFVCAS V MYAK +V+E+ Sbjct: 107 VIRTCRDRTDLQIGRVIHDVVLKHGLLSDHFVCASLVDMYAKCIVVED 154 Score = 33.1 bits (74), Expect(2) = 1e-06 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +1 Query: 1 LRCGVTPGNYTLPF 42 LRCGVTP NYTLPF Sbjct: 93 LRCGVTPDNYTLPF 106 >gb|PNY14599.1| pentatricopeptide repeat-containing protein at1g08070-like protein [Trifolium pratense] Length = 573 Score = 47.0 bits (110), Expect(2) = 2e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +2 Query: 86 VVLKYGLLLDHFVCASFVHMYAKFMVIEN 172 VVLK+GL LDHFVCA+ V MYAK MVIE+ Sbjct: 126 VVLKHGLQLDHFVCATLVDMYAKCMVIED 154 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 1 LRCGVTPGNYTLPF 42 +RCGVTP NYTLPF Sbjct: 93 IRCGVTPDNYTLPF 106 >ref|XP_013467967.1| organelle transcript processing protein, putative [Medicago truncatula] gb|KEH42004.1| organelle transcript processing protein, putative [Medicago truncatula] Length = 574 Score = 47.8 bits (112), Expect(2) = 4e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +2 Query: 86 VVLKYGLLLDHFVCASFVHMYAKFMVIEN 172 VVLKYGL+LDHFVCA+ V MYAK VIE+ Sbjct: 126 VVLKYGLVLDHFVCATLVDMYAKCAVIED 154 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +1 Query: 1 LRCGVTPGNYTLPF 42 LRC +TP NYTLPF Sbjct: 93 LRCNITPDNYTLPF 106 >ref|XP_004515218.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cicer arietinum] Length = 573 Score = 49.3 bits (116), Expect(2) = 4e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +2 Query: 86 VVLKYGLLLDHFVCASFVHMYAKFMVIEN 172 VVLK+GLLLDHFVCA+ V MYAK MVIE+ Sbjct: 126 VVLKHGLLLDHFVCATLVDMYAKCMVIED 154 Score = 28.9 bits (63), Expect(2) = 4e-06 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 1 LRCGVTPGNYTLPF 42 LR GVTP NYTLPF Sbjct: 93 LRYGVTPDNYTLPF 106 >ref|XP_004515217.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Cicer arietinum] Length = 573 Score = 49.3 bits (116), Expect(2) = 4e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +2 Query: 86 VVLKYGLLLDHFVCASFVHMYAKFMVIEN 172 VVLK+GLLLDHFVCA+ V MYAK MVIE+ Sbjct: 126 VVLKHGLLLDHFVCATLVDMYAKCMVIED 154 Score = 28.9 bits (63), Expect(2) = 4e-06 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 1 LRCGVTPGNYTLPF 42 LR GVTP NYTLPF Sbjct: 93 LRYGVTPDNYTLPF 106