BLASTX nr result
ID: Astragalus24_contig00024604
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00024604 (502 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX74567.1| xylogalacturonan beta-xylosyltransferase, partial... 53 8e-06 >gb|PNX74567.1| xylogalacturonan beta-xylosyltransferase, partial [Trifolium pratense] Length = 117 Score = 52.8 bits (125), Expect = 8e-06 Identities = 26/52 (50%), Positives = 33/52 (63%) Frame = +3 Query: 336 YRIGNGLSSL*SSPWLEFGRLRVLV*YIDIHDTSLCI*DVILNDN*HLQDLY 491 +R G+G SSL +PW GRL LV Y+DIHD L + DV+ N H Q+LY Sbjct: 65 WRAGSGSSSLWLTPWTTLGRLGSLVPYVDIHDLQLSVKDVLSTGNPHTQNLY 116