BLASTX nr result
ID: Astragalus24_contig00023828
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00023828 (319 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU18610.1| hypothetical protein TSUD_124410 [Trifolium subt... 60 2e-08 gb|KYP78795.1| Putative metal tolerance protein C3, partial [Caj... 55 1e-07 ref|XP_003600560.1| Mn-specific cation diffusion facilitator tra... 57 3e-07 ref|XP_003600559.1| Mn-specific cation diffusion facilitator tra... 57 4e-07 ref|XP_004500396.1| PREDICTED: metal tolerance protein 4-like [C... 57 4e-07 gb|PNX76114.1| metal tolerance protein 4-like, partial [Trifoliu... 57 5e-07 ref|XP_004490736.1| PREDICTED: metal tolerance protein 4-like [C... 55 1e-06 ref|XP_020211820.1| metal tolerance protein 4-like [Cajanus caja... 55 1e-06 ref|XP_019419593.1| PREDICTED: metal tolerance protein 4-like is... 55 2e-06 ref|XP_019419592.1| PREDICTED: metal tolerance protein 4-like is... 55 2e-06 ref|XP_013454181.1| Mn-specific cation diffusion facilitator tra... 54 3e-06 ref|XP_013454179.1| Mn-specific cation diffusion facilitator tra... 54 4e-06 ref|XP_013454180.1| Mn-specific cation diffusion facilitator tra... 54 4e-06 ref|XP_003616059.1| Mn-specific cation diffusion facilitator tra... 54 4e-06 gb|EEF32026.1| cation efflux protein/ zinc transporter, putative... 54 5e-06 gb|KRG98100.1| hypothetical protein GLYMA_18G050400 [Glycine max] 54 5e-06 ref|XP_002530365.2| PREDICTED: metal tolerance protein 4 [Ricinu... 54 6e-06 gb|KHN18644.1| Metal tolerance protein 4 [Glycine soja] 54 6e-06 ref|NP_001242003.1| cation efflux family protein [Glycine max] >... 54 6e-06 gb|PNX91935.1| metal tolerance protein 4-like [Trifolium pratense] 54 6e-06 >dbj|GAU18610.1| hypothetical protein TSUD_124410 [Trifolium subterraneum] Length = 390 Score = 60.5 bits (145), Expect = 2e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 IENDPSEKM AEQLIWLYSIMIFATVVKL+L Sbjct: 190 IENDPSEKMTAEQLIWLYSIMIFATVVKLIL 220 >gb|KYP78795.1| Putative metal tolerance protein C3, partial [Cajanus cajan] Length = 110 Score = 55.5 bits (132), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 I+N P EKM AEQLIWLYSIMIF+TVVKLML Sbjct: 4 IQNSPPEKMTAEQLIWLYSIMIFSTVVKLML 34 >ref|XP_003600560.1| Mn-specific cation diffusion facilitator transporter MTP8.1 [Medicago truncatula] gb|AES70811.1| Mn-specific cation diffusion facilitator transporter MTP8.1 [Medicago truncatula] Length = 330 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 IEN PSEKM +EQLIWLYSIMIFATVVKL+L Sbjct: 204 IENSPSEKMTSEQLIWLYSIMIFATVVKLIL 234 >ref|XP_003600559.1| Mn-specific cation diffusion facilitator transporter MTP8.1 [Medicago truncatula] gb|AES70810.1| Mn-specific cation diffusion facilitator transporter MTP8.1 [Medicago truncatula] Length = 403 Score = 57.0 bits (136), Expect = 4e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 IEN PSEKM +EQLIWLYSIMIFATVVKL+L Sbjct: 204 IENSPSEKMTSEQLIWLYSIMIFATVVKLIL 234 >ref|XP_004500396.1| PREDICTED: metal tolerance protein 4-like [Cicer arietinum] Length = 410 Score = 57.0 bits (136), Expect = 4e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 IEN PSEKM +EQLIWLYSIMIFATVVKL+L Sbjct: 210 IENSPSEKMTSEQLIWLYSIMIFATVVKLIL 240 >gb|PNX76114.1| metal tolerance protein 4-like, partial [Trifolium pratense] Length = 341 Score = 56.6 bits (135), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 IEN P EKM AEQLIWLYSIMIFATVVKL+L Sbjct: 200 IENSPGEKMTAEQLIWLYSIMIFATVVKLIL 230 >ref|XP_004490736.1| PREDICTED: metal tolerance protein 4-like [Cicer arietinum] Length = 397 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 IEN+PSEKM+ EQL+WLYSIMIFATVVKL L Sbjct: 197 IENNPSEKMSYEQLVWLYSIMIFATVVKLAL 227 >ref|XP_020211820.1| metal tolerance protein 4-like [Cajanus cajan] gb|KYP76089.1| Putative metal tolerance protein C3 [Cajanus cajan] Length = 408 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 I+N P EKM AEQLIWLYSIMIF+TVVKLML Sbjct: 208 IQNSPPEKMTAEQLIWLYSIMIFSTVVKLML 238 >ref|XP_019419593.1| PREDICTED: metal tolerance protein 4-like isoform X2 [Lupinus angustifolius] Length = 391 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 IEN PSEKM EQLIWLYSIMIFATVVK L Sbjct: 216 IENSPSEKMTTEQLIWLYSIMIFATVVKFFL 246 >ref|XP_019419592.1| PREDICTED: metal tolerance protein 4-like isoform X1 [Lupinus angustifolius] gb|OIV95673.1| hypothetical protein TanjilG_01467 [Lupinus angustifolius] Length = 416 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 IEN PSEKM EQLIWLYSIMIFATVVK L Sbjct: 216 IENSPSEKMTTEQLIWLYSIMIFATVVKFFL 246 >ref|XP_013454181.1| Mn-specific cation diffusion facilitator transporter MTP8.1 [Medicago truncatula] gb|KEH28212.1| Mn-specific cation diffusion facilitator transporter MTP8.1 [Medicago truncatula] Length = 246 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 I+NDPSEKM+ +QL+WLYSIMIFAT+VKL L Sbjct: 197 IQNDPSEKMSYDQLVWLYSIMIFATLVKLAL 227 >ref|XP_013454179.1| Mn-specific cation diffusion facilitator transporter MTP8.1 [Medicago truncatula] gb|KEH28210.1| Mn-specific cation diffusion facilitator transporter MTP8.1 [Medicago truncatula] Length = 317 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 I+NDPSEKM+ +QL+WLYSIMIFAT+VKL L Sbjct: 197 IQNDPSEKMSYDQLVWLYSIMIFATLVKLAL 227 >ref|XP_013454180.1| Mn-specific cation diffusion facilitator transporter MTP8.1 [Medicago truncatula] gb|KEH28211.1| Mn-specific cation diffusion facilitator transporter MTP8.1 [Medicago truncatula] Length = 342 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 I+NDPSEKM+ +QL+WLYSIMIFAT+VKL L Sbjct: 144 IQNDPSEKMSYDQLVWLYSIMIFATLVKLAL 174 >ref|XP_003616059.1| Mn-specific cation diffusion facilitator transporter MTP8.1 [Medicago truncatula] gb|AES99017.1| Mn-specific cation diffusion facilitator transporter MTP8.1 [Medicago truncatula] Length = 395 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 I+NDPSEKM+ +QL+WLYSIMIFAT+VKL L Sbjct: 197 IQNDPSEKMSYDQLVWLYSIMIFATLVKLAL 227 >gb|EEF32026.1| cation efflux protein/ zinc transporter, putative [Ricinus communis] Length = 257 Score = 53.5 bits (127), Expect = 5e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 I+N+PSEKMN+EQLIWLY+IM+ ATVVKL+L Sbjct: 56 IQNNPSEKMNSEQLIWLYTIMLTATVVKLIL 86 >gb|KRG98100.1| hypothetical protein GLYMA_18G050400 [Glycine max] Length = 294 Score = 53.5 bits (127), Expect = 5e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 I+N P+E M EQLIWLYSIMIFATVVKLML Sbjct: 94 IQNSPAEMMTTEQLIWLYSIMIFATVVKLML 124 >ref|XP_002530365.2| PREDICTED: metal tolerance protein 4 [Ricinus communis] Length = 366 Score = 53.5 bits (127), Expect = 6e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 I+N+PSEKMN+EQLIWLY+IM+ ATVVKL+L Sbjct: 165 IQNNPSEKMNSEQLIWLYTIMLTATVVKLIL 195 >gb|KHN18644.1| Metal tolerance protein 4 [Glycine soja] Length = 409 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 I+N P+E M EQLIWLYSIMIFATVVKLML Sbjct: 209 IQNSPAEMMTTEQLIWLYSIMIFATVVKLML 239 >ref|NP_001242003.1| cation efflux family protein [Glycine max] gb|ACU18014.1| unknown [Glycine max] Length = 409 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 I+N P+E M EQLIWLYSIMIFATVVKLML Sbjct: 209 IQNSPAEMMTTEQLIWLYSIMIFATVVKLML 239 >gb|PNX91935.1| metal tolerance protein 4-like [Trifolium pratense] Length = 438 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 1 IENDPSEKMNAEQLIWLYSIMIFATVVKLML 93 IEN+PSEKM+ EQL+WLY IMIFATVVKL L Sbjct: 198 IENNPSEKMSYEQLVWLYCIMIFATVVKLAL 228