BLASTX nr result
ID: Astragalus24_contig00023458
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00023458 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004503502.1| PREDICTED: putative dual specificity protein... 69 2e-11 gb|KHN16659.1| Protein-tyrosine phosphatase mitochondrial 1 [Gly... 68 5e-11 gb|OVA14395.1| hypothetical protein BVC80_8555g12 [Macleaya cord... 65 6e-11 ref|XP_020215735.1| putative dual specificity protein phosphatas... 68 9e-11 ref|XP_017440709.1| PREDICTED: putative dual specificity protein... 68 9e-11 ref|XP_014505970.1| putative dual specificity protein phosphatas... 68 9e-11 ref|XP_007160269.1| hypothetical protein PHAVU_002G307100g [Phas... 68 9e-11 ref|NP_001242698.2| protein-tyrosine phosphatase mitochondrial 1... 68 9e-11 ref|XP_003530527.1| PREDICTED: putative dual specificity protein... 68 9e-11 ref|XP_020974325.1| putative dual specificity protein phosphatas... 67 1e-10 ref|XP_015954183.1| putative dual specificity protein phosphatas... 67 1e-10 ref|XP_023547253.1| putative dual specificity protein phosphatas... 67 2e-10 ref|XP_023521512.1| putative dual specificity protein phosphatas... 67 2e-10 ref|XP_022999518.1| putative dual specificity protein phosphatas... 67 2e-10 ref|XP_022946630.1| putative dual specificity protein phosphatas... 67 2e-10 ref|XP_015899462.1| PREDICTED: putative dual specificity protein... 67 2e-10 gb|POO00573.1| Dual specificity phosphatase [Trema orientalis] 67 2e-10 gb|PON62483.1| Dual specificity phosphatase [Parasponia andersonii] 67 2e-10 ref|XP_008459068.1| PREDICTED: putative dual specificity protein... 67 2e-10 ref|XP_004141033.1| PREDICTED: putative dual specificity protein... 67 2e-10 >ref|XP_004503502.1| PREDICTED: putative dual specificity protein phosphatase DSP8 [Cicer arietinum] ref|XP_012572096.1| PREDICTED: putative dual specificity protein phosphatase DSP8 [Cicer arietinum] Length = 277 Score = 69.3 bits (168), Expect = 2e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNKMEAEFRWWDQIDE LL Sbjct: 38 RILFYPTLLYNVLRNKMEAEFRWWDQIDEFLL 69 >gb|KHN16659.1| Protein-tyrosine phosphatase mitochondrial 1 [Glycine soja] Length = 223 Score = 67.8 bits (164), Expect = 5e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNK+EAEFRWWDQIDE LL Sbjct: 38 RILFYPTLLYNVLRNKIEAEFRWWDQIDEFLL 69 >gb|OVA14395.1| hypothetical protein BVC80_8555g12 [Macleaya cordata] Length = 109 Score = 65.1 bits (157), Expect = 6e-11 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLLFLSLCIFFHAGFLLQFIFRL 251 RILFYPTL+YNV RNK+E EF WWD+ID V +L IF H + F F+L Sbjct: 57 RILFYPTLMYNVARNKIEPEFHWWDEIDPV-TYLHFTIFIHPPYFCYFKFQL 107 >ref|XP_020215735.1| putative dual specificity protein phosphatase DSP8 [Cajanus cajan] ref|XP_020215736.1| putative dual specificity protein phosphatase DSP8 [Cajanus cajan] gb|KYP67497.1| hypothetical protein KK1_023840 [Cajanus cajan] Length = 277 Score = 67.8 bits (164), Expect = 9e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNK+EAEFRWWDQIDE LL Sbjct: 33 RILFYPTLLYNVLRNKIEAEFRWWDQIDEFLL 64 >ref|XP_017440709.1| PREDICTED: putative dual specificity protein phosphatase DSP8 isoform X1 [Vigna angularis] ref|XP_017440710.1| PREDICTED: putative dual specificity protein phosphatase DSP8 isoform X2 [Vigna angularis] dbj|BAT72891.1| hypothetical protein VIGAN_01033400 [Vigna angularis var. angularis] Length = 282 Score = 67.8 bits (164), Expect = 9e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNK+EAEFRWWDQIDE LL Sbjct: 38 RILFYPTLLYNVLRNKIEAEFRWWDQIDEFLL 69 >ref|XP_014505970.1| putative dual specificity protein phosphatase DSP8 [Vigna radiata var. radiata] ref|XP_014505971.1| putative dual specificity protein phosphatase DSP8 [Vigna radiata var. radiata] Length = 282 Score = 67.8 bits (164), Expect = 9e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNK+EAEFRWWDQIDE LL Sbjct: 38 RILFYPTLLYNVLRNKIEAEFRWWDQIDEFLL 69 >ref|XP_007160269.1| hypothetical protein PHAVU_002G307100g [Phaseolus vulgaris] ref|XP_007160270.1| hypothetical protein PHAVU_002G307100g [Phaseolus vulgaris] gb|ESW32263.1| hypothetical protein PHAVU_002G307100g [Phaseolus vulgaris] gb|ESW32264.1| hypothetical protein PHAVU_002G307100g [Phaseolus vulgaris] Length = 282 Score = 67.8 bits (164), Expect = 9e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNK+EAEFRWWDQIDE LL Sbjct: 38 RILFYPTLLYNVLRNKIEAEFRWWDQIDEFLL 69 >ref|NP_001242698.2| protein-tyrosine phosphatase mitochondrial 1-like [Glycine max] gb|KHM99822.1| Protein-tyrosine phosphatase mitochondrial 1 [Glycine soja] gb|KRH60189.1| hypothetical protein GLYMA_05G225200 [Glycine max] gb|KRH60190.1| hypothetical protein GLYMA_05G225200 [Glycine max] Length = 282 Score = 67.8 bits (164), Expect = 9e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNK+EAEFRWWDQIDE LL Sbjct: 38 RILFYPTLLYNVLRNKIEAEFRWWDQIDEFLL 69 >ref|XP_003530527.1| PREDICTED: putative dual specificity protein phosphatase DSP8 [Glycine max] gb|KRH41470.1| hypothetical protein GLYMA_08G032000 [Glycine max] Length = 282 Score = 67.8 bits (164), Expect = 9e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNK+EAEFRWWDQIDE LL Sbjct: 38 RILFYPTLLYNVLRNKIEAEFRWWDQIDEFLL 69 >ref|XP_020974325.1| putative dual specificity protein phosphatase DSP8 [Arachis ipaensis] Length = 281 Score = 67.4 bits (163), Expect = 1e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNK+EAEFRWWDQ+DE LL Sbjct: 37 RILFYPTLLYNVLRNKIEAEFRWWDQVDEFLL 68 >ref|XP_015954183.1| putative dual specificity protein phosphatase DSP8 [Arachis duranensis] ref|XP_015954184.1| putative dual specificity protein phosphatase DSP8 [Arachis duranensis] Length = 284 Score = 67.4 bits (163), Expect = 1e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNK+EAEFRWWDQ+DE LL Sbjct: 40 RILFYPTLLYNVLRNKIEAEFRWWDQVDEFLL 71 >ref|XP_023547253.1| putative dual specificity protein phosphatase DSP8 [Cucurbita pepo subsp. pepo] ref|XP_023547270.1| putative dual specificity protein phosphatase DSP8 [Cucurbita pepo subsp. pepo] Length = 284 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNKMEAEFRWWD+ID+ LL Sbjct: 37 RILFYPTLLYNVLRNKMEAEFRWWDEIDQFLL 68 >ref|XP_023521512.1| putative dual specificity protein phosphatase DSP8 [Cucurbita pepo subsp. pepo] Length = 284 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNKMEAEFRWWD+ID+ LL Sbjct: 37 RILFYPTLLYNVLRNKMEAEFRWWDEIDQFLL 68 >ref|XP_022999518.1| putative dual specificity protein phosphatase DSP8 [Cucurbita maxima] Length = 284 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNKMEAEFRWWD+ID+ LL Sbjct: 37 RILFYPTLLYNVLRNKMEAEFRWWDEIDQFLL 68 >ref|XP_022946630.1| putative dual specificity protein phosphatase DSP8 [Cucurbita moschata] Length = 284 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNKMEAEFRWWD+ID+ LL Sbjct: 37 RILFYPTLLYNVLRNKMEAEFRWWDEIDQFLL 68 >ref|XP_015899462.1| PREDICTED: putative dual specificity protein phosphatase DSP8 [Ziziphus jujuba] ref|XP_015899463.1| PREDICTED: putative dual specificity protein phosphatase DSP8 [Ziziphus jujuba] Length = 282 Score = 66.6 bits (161), Expect = 2e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNKMEAEFRWWD++D+ LL Sbjct: 37 RILFYPTLLYNVLRNKMEAEFRWWDEVDQFLL 68 >gb|POO00573.1| Dual specificity phosphatase [Trema orientalis] Length = 283 Score = 66.6 bits (161), Expect = 2e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNKMEAEFRWWD++D+ LL Sbjct: 38 RILFYPTLLYNVLRNKMEAEFRWWDEVDQFLL 69 >gb|PON62483.1| Dual specificity phosphatase [Parasponia andersonii] Length = 283 Score = 66.6 bits (161), Expect = 2e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNKMEAEFRWWD++D+ LL Sbjct: 38 RILFYPTLLYNVLRNKMEAEFRWWDEVDQFLL 69 >ref|XP_008459068.1| PREDICTED: putative dual specificity protein phosphatase DSP8 [Cucumis melo] Length = 285 Score = 66.6 bits (161), Expect = 2e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNKMEAEFRWWD++D+ LL Sbjct: 38 RILFYPTLLYNVLRNKMEAEFRWWDEVDQFLL 69 >ref|XP_004141033.1| PREDICTED: putative dual specificity protein phosphatase DSP8 [Cucumis sativus] gb|KGN60562.1| hypothetical protein Csa_2G000700 [Cucumis sativus] Length = 285 Score = 66.6 bits (161), Expect = 2e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 406 RILFYPTLLYNVLRNKMEAEFRWWDQIDEVLL 311 RILFYPTLLYNVLRNKMEAEFRWWD++D+ LL Sbjct: 38 RILFYPTLLYNVLRNKMEAEFRWWDEVDQFLL 69