BLASTX nr result
ID: Astragalus24_contig00023272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00023272 (400 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001236763.1| putative SAUR-like auxin-responsive protein ... 105 1e-26 ref|XP_006578762.1| PREDICTED: auxin-induced protein 6B-like [Gl... 102 8e-26 gb|KHN09659.1| Auxin-induced protein 6B [Glycine soja] 100 7e-25 ref|XP_014524491.1| auxin-induced protein 6B [Vigna radiata var.... 99 2e-24 ref|XP_017421346.1| PREDICTED: auxin-induced protein 6B-like [Vi... 97 1e-23 ref|XP_015937466.1| auxin-induced protein 6B [Arachis duranensis] 97 2e-23 ref|XP_003630381.1| SAUR-like auxin-responsive family protein [M... 95 1e-22 dbj|GAU19535.1| hypothetical protein TSUD_303480 [Trifolium subt... 94 3e-22 gb|PNX67771.1| auxin-induced protein 6b-like [Trifolium pratense] 92 2e-21 gb|PON88812.1| Small auxin-up RNA [Trema orientalis] 91 3e-21 ref|XP_013461602.1| SAUR-like auxin-responsive family protein [M... 91 6e-21 ref|XP_016169280.1| auxin-induced protein 6B [Arachis ipaensis] 91 8e-21 dbj|GAU25417.1| hypothetical protein TSUD_70700 [Trifolium subte... 90 9e-21 gb|PNX83052.1| auxin-induced protein 6B [Trifolium pratense] 90 9e-21 ref|XP_003532148.1| PREDICTED: auxin-responsive protein SAUR32-l... 90 1e-20 gb|PON66588.1| Small auxin-up RNA [Parasponia andersonii] 89 2e-20 ref|XP_020221965.1| auxin-induced protein 6B-like [Cajanus cajan... 89 3e-20 ref|NP_001236702.1| putative SAUR-like auxin-responsive protein ... 88 4e-20 ref|XP_002300214.1| hypothetical protein POPTR_0001s31380g [Popu... 88 4e-20 ref|XP_017614837.1| PREDICTED: auxin-responsive protein SAUR32-l... 88 6e-20 >ref|NP_001236763.1| putative SAUR-like auxin-responsive protein [Glycine max] gb|ACU14040.1| unknown [Glycine max] gb|KRH53979.1| hypothetical protein GLYMA_06G158700 [Glycine max] Length = 107 Score = 105 bits (261), Expect = 1e-26 Identities = 49/59 (83%), Positives = 52/59 (88%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYHPHRLPLATLHFPHSC 179 KARE+YGYHTDGPLKLPCSVDDFLHLRWRIEKES+P NHHN+ HRLP A LHF HSC Sbjct: 51 KAREVYGYHTDGPLKLPCSVDDFLHLRWRIEKESAPNQNHHNHSHHRLPHA-LHF-HSC 107 >ref|XP_006578762.1| PREDICTED: auxin-induced protein 6B-like [Glycine max] gb|KRH63954.1| hypothetical protein GLYMA_04G206800 [Glycine max] Length = 107 Score = 102 bits (255), Expect = 8e-26 Identities = 48/59 (81%), Positives = 51/59 (86%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYHPHRLPLATLHFPHSC 179 KARE+YGYHTDGPLKLPCSVDDFLHLRWRI+KES+P NHHN HRLP A LHF HSC Sbjct: 51 KAREVYGYHTDGPLKLPCSVDDFLHLRWRIQKESTPNQNHHNQSHHRLPHA-LHF-HSC 107 >gb|KHN09659.1| Auxin-induced protein 6B [Glycine soja] Length = 108 Score = 100 bits (249), Expect = 7e-25 Identities = 49/60 (81%), Positives = 52/60 (86%), Gaps = 1/60 (1%) Frame = +3 Query: 3 KAR-EIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYHPHRLPLATLHFPHSC 179 KAR E+YGYHTDGPLKLPCSVDDFLHLRWRIEKES+P NHHN+ HRLP A LHF HSC Sbjct: 51 KARGEVYGYHTDGPLKLPCSVDDFLHLRWRIEKESAPNQNHHNHSHHRLPHA-LHF-HSC 108 >ref|XP_014524491.1| auxin-induced protein 6B [Vigna radiata var. radiata] Length = 107 Score = 99.4 bits (246), Expect = 2e-24 Identities = 47/59 (79%), Positives = 51/59 (86%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYHPHRLPLATLHFPHSC 179 KARE+YGYHTDGPLKLPCSVDDFLHLRWRIEKES+ +HHN+ HRLP A LHF HSC Sbjct: 51 KAREVYGYHTDGPLKLPCSVDDFLHLRWRIEKESTSDQHHHNHTNHRLPHA-LHF-HSC 107 >ref|XP_017421346.1| PREDICTED: auxin-induced protein 6B-like [Vigna angularis] gb|KOM41214.1| hypothetical protein LR48_Vigan04g141200 [Vigna angularis] dbj|BAT79255.1| hypothetical protein VIGAN_02210600 [Vigna angularis var. angularis] Length = 107 Score = 97.4 bits (241), Expect = 1e-23 Identities = 46/59 (77%), Positives = 50/59 (84%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYHPHRLPLATLHFPHSC 179 KA E+YGYHTDGPLKLPCSVDDFLHLRWRIEKES+ +HHN+ HRLP A LHF HSC Sbjct: 51 KAHEVYGYHTDGPLKLPCSVDDFLHLRWRIEKESTSDQHHHNHTNHRLPHA-LHF-HSC 107 >ref|XP_015937466.1| auxin-induced protein 6B [Arachis duranensis] Length = 116 Score = 97.1 bits (240), Expect = 2e-23 Identities = 45/64 (70%), Positives = 51/64 (79%), Gaps = 5/64 (7%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKES-----SPLHNHHNYHPHRLPLATLHF 167 KA E+YGYHTDGPLKLPCS+DDFLHLRWRIEKES + HNHH++H HRLP A +F Sbjct: 54 KAYEVYGYHTDGPLKLPCSIDDFLHLRWRIEKESNHHGAASHHNHHSHHNHRLPHALYNF 113 Query: 168 PHSC 179 HSC Sbjct: 114 -HSC 116 >ref|XP_003630381.1| SAUR-like auxin-responsive family protein [Medicago truncatula] gb|AET04857.1| SAUR-like auxin-responsive family protein [Medicago truncatula] Length = 107 Score = 94.7 bits (234), Expect = 1e-22 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYHPHRLPLATLHFPHSC 179 KA EIYGY+TDGPLKLPCSVDDFLHLRWRIEKES+P H+HH +H H L L+F +SC Sbjct: 50 KAYEIYGYNTDGPLKLPCSVDDFLHLRWRIEKESTPYHHHHQHHHHHLIPHALYF-NSC 107 >dbj|GAU19535.1| hypothetical protein TSUD_303480 [Trifolium subterraneum] Length = 108 Score = 94.0 bits (232), Expect = 3e-22 Identities = 41/59 (69%), Positives = 49/59 (83%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYHPHRLPLATLHFPHSC 179 +A ++YGYHT+GPLKLPCSVDDFLHLRWRIEKES P ++HN+H HRLP A + HSC Sbjct: 52 QAYDVYGYHTNGPLKLPCSVDDFLHLRWRIEKESGPNQHNHNHHQHRLPHALIF--HSC 108 >gb|PNX67771.1| auxin-induced protein 6b-like [Trifolium pratense] Length = 108 Score = 91.7 bits (226), Expect = 2e-21 Identities = 40/59 (67%), Positives = 49/59 (83%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYHPHRLPLATLHFPHSC 179 +A ++YGYHT+GPLKLPCSVDDFLHLRWRIEKES P ++HN+H +RLP A + HSC Sbjct: 52 QAYDVYGYHTNGPLKLPCSVDDFLHLRWRIEKESGPNQHNHNHHQYRLPHALIF--HSC 108 >gb|PON88812.1| Small auxin-up RNA [Trema orientalis] Length = 107 Score = 91.3 bits (225), Expect = 3e-21 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 1/60 (1%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYH-PHRLPLATLHFPHSC 179 KA+E+YGYHT GPL+LPCSVDDFLHLRWRIEKES+ H+HH +H H PL+T HSC Sbjct: 48 KAQEVYGYHTAGPLRLPCSVDDFLHLRWRIEKESNQHHHHHGHHQQHHHPLSTSLSFHSC 107 >ref|XP_013461602.1| SAUR-like auxin-responsive family protein [Medicago truncatula] gb|KEH35637.1| SAUR-like auxin-responsive family protein [Medicago truncatula] Length = 106 Score = 90.5 bits (223), Expect = 6e-21 Identities = 42/59 (71%), Positives = 48/59 (81%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYHPHRLPLATLHFPHSC 179 +A ++YGYHT+GPLKLPCSVDDFLHLRWRIEKES HN HN+H HRLP A + HSC Sbjct: 51 QAYDVYGYHTNGPLKLPCSVDDFLHLRWRIEKESPNQHN-HNHHQHRLPHALIF--HSC 106 >ref|XP_016169280.1| auxin-induced protein 6B [Arachis ipaensis] Length = 117 Score = 90.5 bits (223), Expect = 8e-21 Identities = 46/66 (69%), Positives = 51/66 (77%), Gaps = 7/66 (10%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKES------SPLHNHHNYH-PHRLPLATL 161 KA E+YGYHTDGPLKLPCSVDDFLHLRWRIEKES S +NHH++H HRLP A Sbjct: 53 KAYEVYGYHTDGPLKLPCSVDDFLHLRWRIEKESNHHGAASHHNNHHSHHNHHRLPHALY 112 Query: 162 HFPHSC 179 +F HSC Sbjct: 113 NF-HSC 117 >dbj|GAU25417.1| hypothetical protein TSUD_70700 [Trifolium subterraneum] Length = 109 Score = 90.1 bits (222), Expect = 9e-21 Identities = 42/65 (64%), Positives = 51/65 (78%), Gaps = 2/65 (3%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPL--HNHHNYHPHRLPLATLHFPHS 176 KA EIYGY+TDGPLKLPCSVDDF+HLRWRIEKES+P H+HHN+H H L + PH+ Sbjct: 48 KAYEIYGYNTDGPLKLPCSVDDFVHLRWRIEKESTPYNHHHHHNHHHHHLHI----LPHA 103 Query: 177 C*FSN 191 F++ Sbjct: 104 LSFNS 108 >gb|PNX83052.1| auxin-induced protein 6B [Trifolium pratense] Length = 111 Score = 90.1 bits (222), Expect = 9e-21 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYHPH 140 KA EIYGY+TDGPLKLPCSVDDF+HLRWRIEKES+P H+HH++H H Sbjct: 48 KAYEIYGYNTDGPLKLPCSVDDFVHLRWRIEKESTPYHHHHHHHHH 93 >ref|XP_003532148.1| PREDICTED: auxin-responsive protein SAUR32-like [Glycine max] gb|KHN16921.1| Auxin-induced protein 6B [Glycine soja] gb|KRH40994.1| hypothetical protein GLYMA_08G004100 [Glycine max] Length = 105 Score = 89.7 bits (221), Expect = 1e-20 Identities = 42/62 (67%), Positives = 49/62 (79%), Gaps = 3/62 (4%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNH---HNYHPHRLPLATLHFPH 173 KA E+YGYHT+GPLKLPCSVDDFLHLRWRI+KESS H+H HN+H HR L+F H Sbjct: 45 KAYEVYGYHTEGPLKLPCSVDDFLHLRWRIQKESSTHHHHNHNHNHHHHRQLPHALYF-H 103 Query: 174 SC 179 +C Sbjct: 104 AC 105 >gb|PON66588.1| Small auxin-up RNA [Parasponia andersonii] Length = 108 Score = 89.0 bits (219), Expect = 2e-20 Identities = 41/61 (67%), Positives = 48/61 (78%), Gaps = 2/61 (3%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYH--PHRLPLATLHFPHS 176 KA+E+YGYHT GPL+LPCSVDDFLHLRWRIEKES+ H+HH+ H H PL+T HS Sbjct: 48 KAQEVYGYHTAGPLRLPCSVDDFLHLRWRIEKESNQHHHHHHGHHQQHHHPLSTTLPFHS 107 Query: 177 C 179 C Sbjct: 108 C 108 >ref|XP_020221965.1| auxin-induced protein 6B-like [Cajanus cajan] gb|KYP61891.1| Auxin-induced protein 6B [Cajanus cajan] Length = 111 Score = 89.0 bits (219), Expect = 3e-20 Identities = 43/59 (72%), Positives = 46/59 (77%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYHPHRLPLATLHFPHSC 179 KA ++YGYHTDGPLKLPCSVDDFLHLRWRI KESSP H HH+ HP LHF HSC Sbjct: 60 KAYDVYGYHTDGPLKLPCSVDDFLHLRWRIHKESSP-HPHHHTHP-----LALHF-HSC 111 >ref|NP_001236702.1| putative SAUR-like auxin-responsive protein [Glycine max] gb|ACU14780.1| unknown [Glycine max] gb|KHN17415.1| Auxin-induced protein 6B [Glycine soja] gb|KRH59646.1| hypothetical protein GLYMA_05G196300 [Glycine max] Length = 101 Score = 88.2 bits (217), Expect = 4e-20 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 2/61 (3%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHN--HHNYHPHRLPLATLHFPHS 176 KA E+YGYHT+GPLKLPCSVDDFLHLRWRIEKES+ H+ HH++H HR L+F H+ Sbjct: 42 KAYEVYGYHTEGPLKLPCSVDDFLHLRWRIEKESTTHHHHQHHHHHHHRQLPHALYF-HA 100 Query: 177 C 179 C Sbjct: 101 C 101 >ref|XP_002300214.1| hypothetical protein POPTR_0001s31380g [Populus trichocarpa] gb|PNT57544.1| hypothetical protein POPTR_001G306300v3 [Populus trichocarpa] Length = 106 Score = 88.2 bits (217), Expect = 4e-20 Identities = 41/59 (69%), Positives = 50/59 (84%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYHPHRLPLATLHFPHSC 179 KA E+YGYHT GPL++PCSVDDFLHLRWRIEKESS H+HH++H H LP ++L F +SC Sbjct: 51 KAHEVYGYHTTGPLRVPCSVDDFLHLRWRIEKESSH-HSHHSHHQHHLP-SSLSF-YSC 106 >ref|XP_017614837.1| PREDICTED: auxin-responsive protein SAUR32-like [Gossypium arboreum] Length = 103 Score = 87.8 bits (216), Expect = 6e-20 Identities = 42/59 (71%), Positives = 50/59 (84%) Frame = +3 Query: 3 KAREIYGYHTDGPLKLPCSVDDFLHLRWRIEKESSPLHNHHNYHPHRLPLATLHFPHSC 179 KA E+YGYHT GPLKLPCSVDDFL+L+W+IEKES+ H+HH++H H LPL TL F HSC Sbjct: 49 KAYEVYGYHTKGPLKLPCSVDDFLNLKWQIEKESN--HHHHHHHHHHLPL-TLPF-HSC 103