BLASTX nr result
ID: Astragalus24_contig00023214
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00023214 (505 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588759.1| alpha/beta hydrolase fold protein [Medicago ... 37 3e-06 ref|XP_007011874.2| PREDICTED: probable carboxylesterase 17 [The... 38 4e-06 >ref|XP_003588759.1| alpha/beta hydrolase fold protein [Medicago truncatula] gb|AES59010.1| alpha/beta hydrolase fold protein [Medicago truncatula] Length = 312 Score = 36.6 bits (83), Expect(3) = 3e-06 Identities = 20/43 (46%), Positives = 25/43 (58%) Frame = +2 Query: 233 FGSNFEKVVVDSCVWEGVSILLLKFMLRGRIFLKERGVMCVEF 361 FG NFEK V VW + ++ + G+ FLKERGVM EF Sbjct: 225 FGCNFEKDDVSESVW--LKFPAVEVYVAGKDFLKERGVMYAEF 265 Score = 30.8 bits (68), Expect(3) = 3e-06 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 126 PLF*EREREDGTQKYKSDAGVEDGSMNDMFWR 221 P F +R + ++ + + GVED MNDMFWR Sbjct: 184 PYFGSEKRTE--KEMEEEGGVEDVKMNDMFWR 213 Score = 30.4 bits (67), Expect(3) = 3e-06 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +1 Query: 97 VKIKGLMLMHPYFERER 147 VKIKG+ML+HPYF E+ Sbjct: 174 VKIKGVMLIHPYFGSEK 190 >ref|XP_007011874.2| PREDICTED: probable carboxylesterase 17 [Theobroma cacao] Length = 334 Score = 37.7 bits (86), Expect(3) = 4e-06 Identities = 20/43 (46%), Positives = 25/43 (58%) Frame = +2 Query: 233 FGSNFEKVVVDSCVWEGVSILLLKFMLRGRIFLKERGVMCVEF 361 FG NFEK VV W ++++ + G FLKERGVM EF Sbjct: 249 FGCNFEKQVVSEAEWREFPVVVV--YVAGLDFLKERGVMYAEF 289 Score = 30.0 bits (66), Expect(3) = 4e-06 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +1 Query: 97 VKIKGLMLMHPYFERERERT 156 VKIKGL+++HPYF E ERT Sbjct: 199 VKIKGLLMIHPYFGSE-ERT 217 Score = 29.6 bits (65), Expect(3) = 4e-06 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 150 EDGTQKYKSDAGVEDGSMNDMFWR 221 E+ T + ++D D +MNDMFWR Sbjct: 214 EERTDRERADGAAGDVAMNDMFWR 237