BLASTX nr result
ID: Astragalus24_contig00023159
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00023159 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004485514.1| PREDICTED: patatin-like phospholipase domain... 59 1e-07 >ref|XP_004485514.1| PREDICTED: patatin-like phospholipase domain-containing protein 2 [Cicer arietinum] Length = 412 Score = 59.3 bits (142), Expect = 1e-07 Identities = 36/60 (60%), Positives = 39/60 (65%), Gaps = 7/60 (11%) Frame = +3 Query: 237 YRYRFRFPSLNS-YP--NSTLLRTRTLCNYSPQEQRNVQQHST----TXXXXXXEKKSFA 395 +RYRFRFPS N+ YP N LL TRTL NYSP+ RNVQQHST EKKSFA Sbjct: 20 HRYRFRFPSTNNLYPTTNLNLLPTRTLFNYSPRAHRNVQQHSTIPPPPPPPPLPEKKSFA 79