BLASTX nr result
ID: Astragalus24_contig00023083
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00023083 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013453607.1| hypothetical protein MTR_5g024973 [Medicago ... 52 8e-06 >ref|XP_013453607.1| hypothetical protein MTR_5g024973 [Medicago truncatula] gb|KEH27642.1| hypothetical protein MTR_5g024973 [Medicago truncatula] Length = 96 Score = 52.0 bits (123), Expect = 8e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 1 INQFLVPVPLEIKETVVRAYRTDPVQVRSCYV 96 I+Q VPV LEIK+TVVR+YRTDPVQVRSC + Sbjct: 39 IHQTYVPVSLEIKDTVVRSYRTDPVQVRSCLI 70