BLASTX nr result
ID: Astragalus24_contig00023055
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00023055 (353 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012572916.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-07 ref|XP_007134855.1| hypothetical protein PHAVU_010G081900g [Phas... 55 2e-06 ref|XP_007134856.1| hypothetical protein PHAVU_010G081900g [Phas... 55 2e-06 dbj|BAU00711.1| hypothetical protein VIGAN_10232700, partial [Vi... 53 2e-06 ref|XP_017406376.1| PREDICTED: pentatricopeptide repeat-containi... 54 9e-06 dbj|BAT97729.1| hypothetical protein VIGAN_09126000 [Vigna angul... 54 9e-06 ref|XP_017406374.1| PREDICTED: pentatricopeptide repeat-containi... 54 9e-06 >ref|XP_012572916.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Cicer arietinum] Length = 675 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/35 (80%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = +1 Query: 250 KSPFLGLLVSSFHTRSL-SPIVKPINWNTTHSFVR 351 KSP LG+L+S FHT SL SPIVKPINW TTHSFVR Sbjct: 24 KSPNLGVLISFFHTSSLLSPIVKPINWKTTHSFVR 58 >ref|XP_007134855.1| hypothetical protein PHAVU_010G081900g [Phaseolus vulgaris] gb|ESW06849.1| hypothetical protein PHAVU_010G081900g [Phaseolus vulgaris] Length = 578 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 3/49 (6%) Frame = +1 Query: 214 LLILLVNQC---YDSKSPFLGLLVSSFHTRSLSPIVKPINWNTTHSFVR 351 + IL VN+ + K P LGLL HTRSLSP VKPINWNT+HSFVR Sbjct: 1 MFILFVNKLRFRHPLKIPLLGLLCC-LHTRSLSPFVKPINWNTSHSFVR 48 >ref|XP_007134856.1| hypothetical protein PHAVU_010G081900g [Phaseolus vulgaris] gb|ESW06850.1| hypothetical protein PHAVU_010G081900g [Phaseolus vulgaris] Length = 676 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 3/49 (6%) Frame = +1 Query: 214 LLILLVNQC---YDSKSPFLGLLVSSFHTRSLSPIVKPINWNTTHSFVR 351 + IL VN+ + K P LGLL HTRSLSP VKPINWNT+HSFVR Sbjct: 1 MFILFVNKLRFRHPLKIPLLGLLCC-LHTRSLSPFVKPINWNTSHSFVR 48 >dbj|BAU00711.1| hypothetical protein VIGAN_10232700, partial [Vigna angularis var. angularis] Length = 128 Score = 53.1 bits (126), Expect = 2e-06 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 3/49 (6%) Frame = +1 Query: 214 LLILLVNQC---YDSKSPFLGLLVSSFHTRSLSPIVKPINWNTTHSFVR 351 + IL N+ Y K P LGLL HTRSL P VKPINWNT+HSFVR Sbjct: 1 MFILFANKLRFRYPLKIPLLGLLCC-VHTRSLCPYVKPINWNTSHSFVR 48 >ref|XP_017406376.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like isoform X2 [Vigna angularis] Length = 677 Score = 53.5 bits (127), Expect = 9e-06 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 3/49 (6%) Frame = +1 Query: 214 LLILLVNQC---YDSKSPFLGLLVSSFHTRSLSPIVKPINWNTTHSFVR 351 + IL N+ Y K P LGLL HTRSL P VKPINWNT+HSFVR Sbjct: 1 MFILFANKLRFRYPLKIPLLGLLCC-LHTRSLCPYVKPINWNTSHSFVR 48 >dbj|BAT97729.1| hypothetical protein VIGAN_09126000 [Vigna angularis var. angularis] Length = 677 Score = 53.5 bits (127), Expect = 9e-06 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 3/49 (6%) Frame = +1 Query: 214 LLILLVNQC---YDSKSPFLGLLVSSFHTRSLSPIVKPINWNTTHSFVR 351 + IL N+ Y K P LGLL HTRSL P VKPINWNT+HSFVR Sbjct: 1 MFILFANKLRFRYPLKIPLLGLLCC-LHTRSLCPYVKPINWNTSHSFVR 48 >ref|XP_017406374.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like isoform X1 [Vigna angularis] ref|XP_017406375.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like isoform X1 [Vigna angularis] Length = 682 Score = 53.5 bits (127), Expect = 9e-06 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 3/49 (6%) Frame = +1 Query: 214 LLILLVNQC---YDSKSPFLGLLVSSFHTRSLSPIVKPINWNTTHSFVR 351 + IL N+ Y K P LGLL HTRSL P VKPINWNT+HSFVR Sbjct: 1 MFILFANKLRFRYPLKIPLLGLLCC-LHTRSLCPYVKPINWNTSHSFVR 48