BLASTX nr result
ID: Astragalus24_contig00022904
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00022904 (302 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012573587.1| PREDICTED: YLP motif-containing protein 1 is... 58 2e-07 ref|XP_012573586.1| PREDICTED: YLP motif-containing protein 1 is... 58 2e-07 >ref|XP_012573587.1| PREDICTED: YLP motif-containing protein 1 isoform X2 [Cicer arietinum] Length = 683 Score = 57.8 bits (138), Expect = 2e-07 Identities = 34/89 (38%), Positives = 38/89 (42%), Gaps = 1/89 (1%) Frame = +3 Query: 39 MDRQWRPTPRATQFPGNVCPTCLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN 218 MDRQWRP P Q+ N+CP C I N Sbjct: 1 MDRQWRPNPNPIQYQNNLCPNCFIQHFPFCPSPPPPPPPNWPPPPPPPPQPHHQLQPNSN 60 Query: 219 -TFDSDTDRTFKRPRIDDPFNFSDDERRL 302 T+DSD DRTFKRPRID DD+RRL Sbjct: 61 TTYDSDFDRTFKRPRID------DDQRRL 83 >ref|XP_012573586.1| PREDICTED: YLP motif-containing protein 1 isoform X1 [Cicer arietinum] Length = 686 Score = 57.8 bits (138), Expect = 2e-07 Identities = 34/89 (38%), Positives = 38/89 (42%), Gaps = 1/89 (1%) Frame = +3 Query: 39 MDRQWRPTPRATQFPGNVCPTCLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN 218 MDRQWRP P Q+ N+CP C I N Sbjct: 1 MDRQWRPNPNPIQYQNNLCPNCFIQHFPFCPSPPPPPPPNWPPPPPPPPQPHHQLQPNSN 60 Query: 219 -TFDSDTDRTFKRPRIDDPFNFSDDERRL 302 T+DSD DRTFKRPRID DD+RRL Sbjct: 61 TTYDSDFDRTFKRPRID------DDQRRL 83