BLASTX nr result
ID: Astragalus24_contig00022854
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00022854 (320 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004485853.1| PREDICTED: probable leucine-rich repeat rece... 75 2e-13 ref|XP_003593677.1| LRR receptor-like kinase family protein, put... 74 4e-13 ref|XP_016465205.1| PREDICTED: probable sulfate transporter 3.3 ... 71 4e-13 ref|XP_009622161.1| PREDICTED: probable sulfate transporter 3.3 ... 71 4e-13 gb|PNY00172.1| putative sulfate transporter 3.3-like protein [Tr... 72 1e-12 ref|XP_016556981.1| PREDICTED: probable sulfate transporter 3.3 ... 71 1e-12 gb|EYU31825.1| hypothetical protein MIMGU_mgv1a0030182mg, partia... 70 2e-12 dbj|GAU29125.1| hypothetical protein TSUD_58910 [Trifolium subte... 72 3e-12 gb|AKV94662.1| sulfate transporter 3.3-like protein [Pisum sativum] 72 3e-12 ref|XP_013456816.1| sulfate/bicarbonate/oxalate exchanger and tr... 72 3e-12 ref|XP_004505279.1| PREDICTED: probable sulfate transporter 3.3 ... 72 3e-12 ref|XP_014492285.1| probable sulfate transporter 3.3 [Vigna radi... 67 3e-12 ref|XP_009763583.1| PREDICTED: probable sulfate transporter 3.3 ... 71 3e-12 gb|POE82796.1| putative sulfate transporter 3.3 [Quercus suber] 68 3e-12 gb|PHT67216.1| putative sulfate transporter 3.4, partial [Capsic... 71 4e-12 gb|PHU01872.1| putative sulfate transporter 3.4 [Capsicum chinense] 71 4e-12 gb|PHT33325.1| putative sulfate transporter 3.4 [Capsicum baccatum] 71 4e-12 gb|KOM51998.1| hypothetical protein LR48_Vigan09g065700 [Vigna a... 71 4e-12 ref|XP_016495246.1| PREDICTED: probable sulfate transporter 3.3 ... 71 4e-12 ref|XP_020996054.1| probable sulfate transporter 3.3 isoform X2 ... 71 4e-12 >ref|XP_004485853.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Cicer arietinum] Length = 934 Score = 75.1 bits (183), Expect = 2e-13 Identities = 39/68 (57%), Positives = 43/68 (63%) Frame = -2 Query: 205 LAGNKICLEDGANQQSYCKAPQIIXXXXXXXXXXXXXXXXXNQIASPNCNCAFLYTGNLF 26 LA NKICLE+GA+++SYCK PQ I NQIASPNC CAF Y GNL Sbjct: 367 LAQNKICLENGASEKSYCKIPQTIPSYSTPTNGCSPPSCSDNQIASPNCKCAFPYIGNLS 426 Query: 25 FRAFSFSN 2 RAFSFSN Sbjct: 427 SRAFSFSN 434 >ref|XP_003593677.1| LRR receptor-like kinase family protein, putative [Medicago truncatula] gb|AES63928.1| LRR receptor-like kinase family protein, putative [Medicago truncatula] Length = 503 Score = 73.9 bits (180), Expect = 4e-13 Identities = 36/68 (52%), Positives = 43/68 (63%) Frame = -2 Query: 205 LAGNKICLEDGANQQSYCKAPQIIXXXXXXXXXXXXXXXXXNQIASPNCNCAFLYTGNLF 26 LA N+ICLE+G +++SYCK PQ I +QIASPNC CAF Y+GNL Sbjct: 344 LAQNRICLENGVSEESYCKVPQTIPPYSTPSNGCSPPSCSNDQIASPNCKCAFPYSGNLS 403 Query: 25 FRAFSFSN 2 RAFSFSN Sbjct: 404 SRAFSFSN 411 >ref|XP_016465205.1| PREDICTED: probable sulfate transporter 3.3 [Nicotiana tabacum] Length = 182 Score = 71.2 bits (173), Expect = 4e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPL+YAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 111 GLYSSFVPPLVYAVLGSSRDLAVGPVSIASLVLGSMLR 148 >ref|XP_009622161.1| PREDICTED: probable sulfate transporter 3.3 [Nicotiana tomentosiformis] Length = 182 Score = 71.2 bits (173), Expect = 4e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPL+YAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 111 GLYSSFVPPLVYAVLGSSRDLAVGPVSIASLVLGSMLR 148 >gb|PNY00172.1| putative sulfate transporter 3.3-like protein [Trifolium pratense] Length = 268 Score = 71.6 bits (174), Expect = 1e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 112 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLGSMLR 149 >ref|XP_016556981.1| PREDICTED: probable sulfate transporter 3.3 [Capsicum annuum] Length = 246 Score = 71.2 bits (173), Expect = 1e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPL+YAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 113 GLYSSFVPPLVYAVLGSSRDLAVGPVSIASLVLGSMLR 150 >gb|EYU31825.1| hypothetical protein MIMGU_mgv1a0030182mg, partial [Erythranthe guttata] Length = 248 Score = 70.5 bits (171), Expect = 2e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASL++ SMLR Sbjct: 120 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLIMGSMLR 157 >dbj|GAU29125.1| hypothetical protein TSUD_58910 [Trifolium subterraneum] Length = 633 Score = 71.6 bits (174), Expect = 3e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 112 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLGSMLR 149 >gb|AKV94662.1| sulfate transporter 3.3-like protein [Pisum sativum] Length = 654 Score = 71.6 bits (174), Expect = 3e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 113 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLGSMLR 150 >ref|XP_013456816.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago truncatula] gb|KEH30847.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago truncatula] Length = 654 Score = 71.6 bits (174), Expect = 3e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 112 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLGSMLR 149 >ref|XP_004505279.1| PREDICTED: probable sulfate transporter 3.3 [Cicer arietinum] Length = 657 Score = 71.6 bits (174), Expect = 3e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 114 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLGSMLR 151 >ref|XP_014492285.1| probable sulfate transporter 3.3 [Vigna radiata var. radiata] Length = 113 Score = 67.4 bits (163), Expect = 3e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPL+YAVLGSSRDLAVGPVSI SLVL MLR Sbjct: 41 GLYSSFVPPLVYAVLGSSRDLAVGPVSITSLVLGLMLR 78 >ref|XP_009763583.1| PREDICTED: probable sulfate transporter 3.3 [Nicotiana sylvestris] ref|XP_016481917.1| PREDICTED: probable sulfate transporter 3.3 [Nicotiana tabacum] Length = 368 Score = 71.2 bits (173), Expect = 3e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPL+YAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 111 GLYSSFVPPLVYAVLGSSRDLAVGPVSIASLVLGSMLR 148 >gb|POE82796.1| putative sulfate transporter 3.3 [Quercus suber] Length = 129 Score = 67.8 bits (164), Expect = 3e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSML 210 GLYSSFVPPL+YAVLGSSRDLAVGPVSIASL+L S+L Sbjct: 22 GLYSSFVPPLVYAVLGSSRDLAVGPVSIASLILGSLL 58 >gb|PHT67216.1| putative sulfate transporter 3.4, partial [Capsicum annuum] Length = 595 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPL+YAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 98 GLYSSFVPPLVYAVLGSSRDLAVGPVSIASLVLGSMLR 135 >gb|PHU01872.1| putative sulfate transporter 3.4 [Capsicum chinense] Length = 619 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPL+YAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 113 GLYSSFVPPLVYAVLGSSRDLAVGPVSIASLVLGSMLR 150 >gb|PHT33325.1| putative sulfate transporter 3.4 [Capsicum baccatum] Length = 619 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPL+YAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 113 GLYSSFVPPLVYAVLGSSRDLAVGPVSIASLVLGSMLR 150 >gb|KOM51998.1| hypothetical protein LR48_Vigan09g065700 [Vigna angularis] Length = 631 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPL+YAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 113 GLYSSFVPPLVYAVLGSSRDLAVGPVSIASLVLGSMLR 150 >ref|XP_016495246.1| PREDICTED: probable sulfate transporter 3.3 isoform X2 [Nicotiana tabacum] Length = 634 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPL+YAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 112 GLYSSFVPPLVYAVLGSSRDLAVGPVSIASLVLGSMLR 149 >ref|XP_020996054.1| probable sulfate transporter 3.3 isoform X2 [Arachis duranensis] Length = 638 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 320 GLYSSFVPPLIYAVLGSSRDLAVGPVSIASLVLRSMLR 207 GLYSSFVPPL+YAVLGSSRDLAVGPVSIASLVL SMLR Sbjct: 118 GLYSSFVPPLVYAVLGSSRDLAVGPVSIASLVLGSMLR 155