BLASTX nr result
ID: Astragalus24_contig00022802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00022802 (345 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY11702.1| galactinol synthase [Trifolium pratense] 54 8e-06 >gb|PNY11702.1| galactinol synthase [Trifolium pratense] Length = 339 Score = 53.5 bits (127), Expect = 8e-06 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 340 ISTGTEAHAAVNGVEVEPFVQALSDVGRVRYVTAPSAA 227 +S +EAH NGVE EPFVQALS+VGRV+YVTAPSAA Sbjct: 304 LSGNSEAHT--NGVENEPFVQALSEVGRVQYVTAPSAA 339