BLASTX nr result
ID: Astragalus24_contig00022558
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00022558 (317 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004494732.1| PREDICTED: protein PHR1-LIKE 1-like [Cicer a... 58 2e-07 dbj|GAU13546.1| hypothetical protein TSUD_346500 [Trifolium subt... 53 8e-06 >ref|XP_004494732.1| PREDICTED: protein PHR1-LIKE 1-like [Cicer arietinum] ref|XP_004494734.1| PREDICTED: protein PHR1-LIKE 1-like [Cicer arietinum] ref|XP_012569710.1| PREDICTED: protein PHR1-LIKE 1-like [Cicer arietinum] Length = 440 Score = 57.8 bits (138), Expect = 2e-07 Identities = 30/37 (81%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = -3 Query: 315 ATQVSQ*QQ-IPSGEVNSLCNSASATTAPQTKARMRW 208 A QVS QQ IPSGEVN LCNSASA+TAPQTK RMRW Sbjct: 184 ANQVSPKQQHIPSGEVNGLCNSASASTAPQTKPRMRW 220 >dbj|GAU13546.1| hypothetical protein TSUD_346500 [Trifolium subterraneum] Length = 430 Score = 53.1 bits (126), Expect = 8e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -3 Query: 315 ATQVSQ*QQIPSGEVNSLCNSASATTAPQTKARMRW 208 A QVSQ Q PS EVN +CNSASA+TA QTK RMRW Sbjct: 185 AMQVSQNPQTPSAEVNIICNSASASTASQTKPRMRW 220