BLASTX nr result
ID: Astragalus24_contig00022379
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00022379 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626878.2| asparagine-tRNA ligase [Medicago truncatula]... 62 3e-08 gb|PNX81363.1| asparagine-tRNA ligase cytoplasmic 2-like [Trifol... 58 1e-07 dbj|GAU37304.1| hypothetical protein TSUD_354600 [Trifolium subt... 59 4e-07 dbj|GAU37305.1| hypothetical protein TSUD_354610 [Trifolium subt... 59 4e-07 ref|XP_004510218.1| PREDICTED: asparagine--tRNA ligase, cytoplas... 55 8e-06 >ref|XP_003626878.2| asparagine-tRNA ligase [Medicago truncatula] gb|AET01354.2| asparagine-tRNA ligase [Medicago truncatula] Length = 633 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/51 (62%), Positives = 40/51 (78%), Gaps = 3/51 (5%) Frame = +3 Query: 288 MAKETQTQTSNQEPGSVGLDSR---LLTPFKYSNRVQLKSILLEPSDHGAE 431 MAKE QT+T QEPGSV +S+ LLTPFKYSNRVQLK++ L+ +D G+E Sbjct: 1 MAKENQTKTQTQEPGSVEPNSQHLSLLTPFKYSNRVQLKTLFLDRTDGGSE 51 >gb|PNX81363.1| asparagine-tRNA ligase cytoplasmic 2-like [Trifolium pratense] Length = 161 Score = 57.8 bits (138), Expect = 1e-07 Identities = 30/51 (58%), Positives = 39/51 (76%), Gaps = 3/51 (5%) Frame = +3 Query: 288 MAKETQTQTSNQEPGSVGLDSRLLTP---FKYSNRVQLKSILLEPSDHGAE 431 MAK+ QT+T EPGSV +S+ LTP FKYSNRVQLK++LL+ +D G+E Sbjct: 1 MAKQNQTETQTHEPGSVEPNSQHLTPLTPFKYSNRVQLKTLLLDRTDPGSE 51 >dbj|GAU37304.1| hypothetical protein TSUD_354600 [Trifolium subterraneum] Length = 549 Score = 58.5 bits (140), Expect = 4e-07 Identities = 30/51 (58%), Positives = 40/51 (78%), Gaps = 3/51 (5%) Frame = +3 Query: 288 MAKETQTQTSNQEPGSVGLDSRLLTP---FKYSNRVQLKSILLEPSDHGAE 431 MAK+ QT+T +EPGSV +S+ LTP FKYSNRVQLK++LL+ +D G+E Sbjct: 1 MAKQNQTETQTKEPGSVEQNSQHLTPLSPFKYSNRVQLKTLLLDRTDAGSE 51 >dbj|GAU37305.1| hypothetical protein TSUD_354610 [Trifolium subterraneum] Length = 573 Score = 58.5 bits (140), Expect = 4e-07 Identities = 30/51 (58%), Positives = 40/51 (78%), Gaps = 3/51 (5%) Frame = +3 Query: 288 MAKETQTQTSNQEPGSVGLDSRLLTP---FKYSNRVQLKSILLEPSDHGAE 431 MAK+ QT+T +EPGSV +S+ LTP FKYSNRVQLK++LL+ +D G+E Sbjct: 1 MAKQNQTETQTKEPGSVEQNSQHLTPLSPFKYSNRVQLKTLLLDRTDAGSE 51 >ref|XP_004510218.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic 2 [Cicer arietinum] Length = 633 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +3 Query: 303 QTQTSNQEPGSVGLDSRLLTPFKYSNRVQLKSILLEPSDHGAE 431 QTQT N+EPGSVG +S+ L+ F YSNRVQLKS+ L+ +D AE Sbjct: 4 QTQTQNKEPGSVGPNSQPLSNFNYSNRVQLKSLFLDRTDGWAE 46