BLASTX nr result
ID: Astragalus24_contig00022228
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00022228 (479 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020220386.1| pentatricopeptide repeat-containing protein ... 104 7e-23 ref|XP_014521218.1| pentatricopeptide repeat-containing protein ... 102 4e-22 gb|KRH06581.1| hypothetical protein GLYMA_16G031800 [Glycine max] 100 1e-21 ref|XP_003548443.1| PREDICTED: pentatricopeptide repeat-containi... 100 1e-21 ref|XP_017411312.1| PREDICTED: pentatricopeptide repeat-containi... 99 5e-21 ref|XP_007160491.1| hypothetical protein PHAVU_002G326200g [Phas... 95 1e-19 ref|XP_017416530.1| PREDICTED: pentatricopeptide repeat-containi... 92 3e-19 ref|XP_020210199.1| pentatricopeptide repeat-containing protein ... 82 3e-15 ref|XP_015947778.2| pentatricopeptide repeat-containing protein ... 82 6e-15 ref|XP_016184971.1| pentatricopeptide repeat-containing protein ... 80 2e-14 ref|XP_019420896.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-11 ref|XP_018841216.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-09 ref|XP_022147524.1| pentatricopeptide repeat-containing protein ... 65 4e-09 ref|XP_007051704.2| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 ref|XP_018841218.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 gb|EOX95861.1| Pentatricopeptide repeat superfamily protein, put... 62 5e-08 gb|KDP28560.1| hypothetical protein JCGZ_14331 [Jatropha curcas] 57 7e-07 ref|XP_015899583.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_021850488.1| pentatricopeptide repeat-containing protein ... 58 1e-06 gb|EEF50591.1| pentatricopeptide repeat-containing protein, puta... 57 1e-06 >ref|XP_020220386.1| pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Cajanus cajan] Length = 768 Score = 104 bits (259), Expect = 7e-23 Identities = 58/89 (65%), Positives = 68/89 (76%), Gaps = 1/89 (1%) Frame = -3 Query: 264 LRPFLFDSSPLSSHQVLQITLRLASIPKALDFLNYLRANSNAN-TQYLSSVFQGALELAT 88 LRPFL D+S H +LQITLRL SIPKALDFLN+LR + + Q LS F+GALELA+ Sbjct: 70 LRPFLVDAS----HHLLQITLRLNSIPKALDFLNFLRDKTEIHHPQALSYAFEGALELAS 125 Query: 87 RHPNSQSELLMLYSFRKSNDCTIPLTAES 1 RHPNSQ+ELLML+S+ KSN C I LTA S Sbjct: 126 RHPNSQNELLMLHSYLKSNACAISLTANS 154 >ref|XP_014521218.1| pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Vigna radiata var. radiata] Length = 760 Score = 102 bits (253), Expect = 4e-22 Identities = 55/88 (62%), Positives = 69/88 (78%) Frame = -3 Query: 264 LRPFLFDSSPLSSHQVLQITLRLASIPKALDFLNYLRANSNANTQYLSSVFQGALELATR 85 LRPFLF++S H +L +TLRL SIPKALDF+NYLR+ + + Q LS VF+GALELAT+ Sbjct: 62 LRPFLFEAS----HHLLPVTLRLNSIPKALDFINYLRSRTEHH-QALSCVFEGALELATQ 116 Query: 84 HPNSQSELLMLYSFRKSNDCTIPLTAES 1 HPNSQ ELL+L+S+RKSN I LT+ S Sbjct: 117 HPNSQKELLILHSYRKSNGDNIALTSRS 144 >gb|KRH06581.1| hypothetical protein GLYMA_16G031800 [Glycine max] Length = 590 Score = 100 bits (249), Expect = 1e-21 Identities = 54/89 (60%), Positives = 67/89 (75%), Gaps = 1/89 (1%) Frame = -3 Query: 264 LRPFLFDSSPLSSHQVLQITLRLASIPKALDFLNYLRANSNANTQY-LSSVFQGALELAT 88 L LF+ SPLSSH LQITL+L+SIPK+L FL YL A + + + LSSVFQG+LELA+ Sbjct: 55 LHSILFNPSPLSSHHFLQITLQLSSIPKSLQFLKYLSAKAPQHHPHSLSSVFQGSLELAS 114 Query: 87 RHPNSQSELLMLYSFRKSNDCTIPLTAES 1 RHPNSQ+ LL L+ FRKS T+PLT +S Sbjct: 115 RHPNSQTHLLSLHRFRKSTHPTLPLTPKS 143 >ref|XP_003548443.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Glycine max] gb|KRH06580.1| hypothetical protein GLYMA_16G031800 [Glycine max] Length = 746 Score = 100 bits (249), Expect = 1e-21 Identities = 54/89 (60%), Positives = 67/89 (75%), Gaps = 1/89 (1%) Frame = -3 Query: 264 LRPFLFDSSPLSSHQVLQITLRLASIPKALDFLNYLRANSNANTQY-LSSVFQGALELAT 88 L LF+ SPLSSH LQITL+L+SIPK+L FL YL A + + + LSSVFQG+LELA+ Sbjct: 55 LHSILFNPSPLSSHHFLQITLQLSSIPKSLQFLKYLSAKAPQHHPHSLSSVFQGSLELAS 114 Query: 87 RHPNSQSELLMLYSFRKSNDCTIPLTAES 1 RHPNSQ+ LL L+ FRKS T+PLT +S Sbjct: 115 RHPNSQTHLLSLHRFRKSTHPTLPLTPKS 143 >ref|XP_017411312.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Vigna angularis] gb|KOM30309.1| hypothetical protein LR48_Vigan1091s002100 [Vigna angularis] dbj|BAT72667.1| hypothetical protein VIGAN_01009300 [Vigna angularis var. angularis] Length = 760 Score = 99.0 bits (245), Expect = 5e-21 Identities = 54/88 (61%), Positives = 68/88 (77%) Frame = -3 Query: 264 LRPFLFDSSPLSSHQVLQITLRLASIPKALDFLNYLRANSNANTQYLSSVFQGALELATR 85 LRPF+F++S +L +TLRL SIPKALDF+NYLR+ + + Q LS VF+GALELAT+ Sbjct: 62 LRPFIFEASD----HLLLVTLRLNSIPKALDFINYLRSRTEHH-QALSCVFEGALELATQ 116 Query: 84 HPNSQSELLMLYSFRKSNDCTIPLTAES 1 HPNSQ ELLML+S+RKSN I LT+ S Sbjct: 117 HPNSQKELLMLHSYRKSNGDNIALTSRS 144 >ref|XP_007160491.1| hypothetical protein PHAVU_002G326200g [Phaseolus vulgaris] gb|ESW32485.1| hypothetical protein PHAVU_002G326200g [Phaseolus vulgaris] Length = 760 Score = 95.1 bits (235), Expect = 1e-19 Identities = 53/88 (60%), Positives = 66/88 (75%) Frame = -3 Query: 264 LRPFLFDSSPLSSHQVLQITLRLASIPKALDFLNYLRANSNANTQYLSSVFQGALELATR 85 LRPFLF++S H +L IT+RL SIPKALDF+N+L + + Q LS VF+GALELAT+ Sbjct: 62 LRPFLFEAS----HHLLHITIRLNSIPKALDFINFL-GDRTEHHQALSRVFEGALELATQ 116 Query: 84 HPNSQSELLMLYSFRKSNDCTIPLTAES 1 HPNSQ ELLML+S+RKS I LT+ S Sbjct: 117 HPNSQKELLMLHSYRKSIGGRIALTSRS 144 >ref|XP_017416530.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Vigna angularis] Length = 347 Score = 92.4 bits (228), Expect = 3e-19 Identities = 49/77 (63%), Positives = 61/77 (79%) Frame = -3 Query: 231 SSHQVLQITLRLASIPKALDFLNYLRANSNANTQYLSSVFQGALELATRHPNSQSELLML 52 +S +L +TLRL SIPKALDF+NYLR+ + + Q LS VF+GALELAT+HPNSQ ELLML Sbjct: 43 ASDHLLLVTLRLNSIPKALDFINYLRSRTEHH-QALSCVFEGALELATQHPNSQKELLML 101 Query: 51 YSFRKSNDCTIPLTAES 1 +S+RKSN I LT+ S Sbjct: 102 HSYRKSNGDNIALTSRS 118 >ref|XP_020210199.1| pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Cajanus cajan] Length = 732 Score = 82.4 bits (202), Expect = 3e-15 Identities = 46/80 (57%), Positives = 59/80 (73%) Frame = -3 Query: 240 SPLSSHQVLQITLRLASIPKALDFLNYLRANSNANTQYLSSVFQGALELATRHPNSQSEL 61 S LSS LQITL+L+SIPK+L+FL YL A + + LSSVFQ +L+LA+RHPNSQ+ L Sbjct: 59 SVLSSEHFLQITLQLSSIPKSLNFLKYLTAKA-PHHHSLSSVFQASLQLASRHPNSQTHL 117 Query: 60 LMLYSFRKSNDCTIPLTAES 1 L L+ FR S T+PLT +S Sbjct: 118 LRLHRFRNSTLPTLPLTPKS 137 >ref|XP_015947778.2| pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Arachis duranensis] Length = 948 Score = 81.6 bits (200), Expect = 6e-15 Identities = 49/100 (49%), Positives = 64/100 (64%), Gaps = 4/100 (4%) Frame = -3 Query: 288 DSSPLSSHLRPFLF-DSSPLSSHQVLQITLRLASIPKALDFLNYLRANSNANTQY---LS 121 DS + L P LF DS PLSS Q+LQIT +L S KALDFL ++R N+ Q+ LS Sbjct: 61 DSHESKNLLLPLLFNDSEPLSSRQILQITRQLGSTTKALDFLEFIRTNAEPEQQHCHLLS 120 Query: 120 SVFQGALELATRHPNSQSELLMLYSFRKSNDCTIPLTAES 1 SVFQ ALELA R S+ E+L L+ + KS + I L+++S Sbjct: 121 SVFQSALELANRDATSKIEVLKLHGYLKSQNWKIDLSSQS 160 >ref|XP_016184971.1| pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Arachis ipaensis] Length = 891 Score = 80.1 bits (196), Expect = 2e-14 Identities = 47/92 (51%), Positives = 61/92 (66%), Gaps = 4/92 (4%) Frame = -3 Query: 264 LRPFLF-DSSPLSSHQVLQITLRLASIPKALDFLNYLRANSNANTQY---LSSVFQGALE 97 L P LF DS PLSS Q+LQIT +L S KALDFL ++R N+ Q+ LSSVFQ ALE Sbjct: 70 LLPLLFNDSEPLSSRQILQITRQLGSTTKALDFLEFIRTNAEPEQQHCHLLSSVFQSALE 129 Query: 96 LATRHPNSQSELLMLYSFRKSNDCTIPLTAES 1 LA R S+ E+L L+ + KS + I L+++S Sbjct: 130 LANRDATSKIEVLKLHGYLKSQNWKIDLSSQS 161 >ref|XP_019420896.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Lupinus angustifolius] gb|OIW17378.1| hypothetical protein TanjilG_22490 [Lupinus angustifolius] Length = 768 Score = 71.6 bits (174), Expect = 2e-11 Identities = 47/105 (44%), Positives = 64/105 (60%), Gaps = 14/105 (13%) Frame = -3 Query: 273 SSHLRPFLFDSSPLSSHQ-VLQITLRLASIPKALDFLNYLRANSNANTQY-LSSVFQGAL 100 S + LF + LSSH LQI+LRL S KA++FL YL N+ +N + LSSVFQGA+ Sbjct: 55 SDKINTLLFKT--LSSHNHFLQISLRLGSSSKAINFLEYLSHNAPSNHHFSLSSVFQGAI 112 Query: 99 ELATRH------------PNSQSELLMLYSFRKSNDCTIPLTAES 1 EL+T PNS+++L+ LY +RKS + T PLT +S Sbjct: 113 ELSTEQQRPSLYSVYHGQPNSENKLIDLYKYRKSKNWTFPLTPKS 157 >ref|XP_018841216.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Juglans regia] Length = 762 Score = 65.1 bits (157), Expect = 3e-09 Identities = 43/95 (45%), Positives = 57/95 (60%), Gaps = 2/95 (2%) Frame = -3 Query: 288 DSSPLSSHLRPFLFDSSPLSSHQVL-QITLRLASIPKALDFLNYLRANS-NANTQYLSSV 115 D S+ L LF SS SS + QITLRLAS +A++F +Y+R+NS + LS Sbjct: 64 DGHSSSTQLHQLLFSSSSPSSPAIFRQITLRLASSSQAIEFFDYIRSNSPSQELTSLSFT 123 Query: 114 FQGALELATRHPNSQSELLMLYSFRKSNDCTIPLT 10 FQ ELA+R P+ Q++LL LY R S + IPLT Sbjct: 124 FQAIFELASREPHPQNKLLELY--RTSKERNIPLT 156 >ref|XP_022147524.1| pentatricopeptide repeat-containing protein At5g28460 [Momordica charantia] Length = 763 Score = 64.7 bits (156), Expect = 4e-09 Identities = 38/84 (45%), Positives = 50/84 (59%), Gaps = 2/84 (2%) Frame = -3 Query: 264 LRPFLFDSSPLSSHQVLQITLRLASIPKALDFLNYLRANS--NANTQYLSSVFQGALELA 91 L LF P S + QIT RL S+ AL FL+Y++ANS ++ + LSS FQ LELA Sbjct: 73 LNHLLFSPIPSSPRRFFQITCRLDSLSTALKFLDYVKANSPPESDRRLLSSTFQAILELA 132 Query: 90 TRHPNSQSELLMLYSFRKSNDCTI 19 TR PNS + LL LY K + ++ Sbjct: 133 TREPNSPNLLLELYKTSKEQNVSL 156 >ref|XP_007051704.2| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Theobroma cacao] Length = 764 Score = 63.5 bits (153), Expect = 1e-08 Identities = 41/92 (44%), Positives = 54/92 (58%), Gaps = 1/92 (1%) Frame = -3 Query: 273 SSHLRPFLFDSSPLSSHQVLQITLRLASIPKALDFLNYLRANS-NANTQYLSSVFQGALE 97 S L+ LF S PLS +LQIT RL S +AL+F +L+ NS + +TQ+LS FQ LE Sbjct: 70 SQPLQSLLFSSPPLSPRFLLQITRRLPSSSEALNFFKHLQQNSPSQDTQFLSYPFQAVLE 129 Query: 96 LATRHPNSQSELLMLYSFRKSNDCTIPLTAES 1 A R P+S + L LY + S IPLT + Sbjct: 130 QAGREPDSATRLSQLY--QDSKQWEIPLTVNA 159 >ref|XP_018841218.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Juglans regia] Length = 766 Score = 62.8 bits (151), Expect = 2e-08 Identities = 43/95 (45%), Positives = 56/95 (58%), Gaps = 2/95 (2%) Frame = -3 Query: 288 DSSPLSSHLRPFLFDSSPLSSHQVL-QITLRLASIPKALDFLNYLRANS-NANTQYLSSV 115 D S+ L LF SS SS + QIT RLAS +AL+F +Y+R+NS + LS Sbjct: 68 DGHSNSTQLHQLLFSSSSPSSPGIFRQITRRLASSSQALEFFDYIRSNSPSQELTSLSFT 127 Query: 114 FQGALELATRHPNSQSELLMLYSFRKSNDCTIPLT 10 FQ ELA+R P+ Q++LL LY R S + IPLT Sbjct: 128 FQAIFELASREPDPQNKLLELY--RTSKERNIPLT 160 >gb|EOX95861.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 764 Score = 61.6 bits (148), Expect = 5e-08 Identities = 40/92 (43%), Positives = 53/92 (57%), Gaps = 1/92 (1%) Frame = -3 Query: 273 SSHLRPFLFDSSPLSSHQVLQITLRLASIPKALDFLNYLRANS-NANTQYLSSVFQGALE 97 S L+ LF S PLS +LQIT RL S +AL+F +L+ NS + + Q+LS FQ LE Sbjct: 70 SQPLQSLLFSSPPLSPRFLLQITRRLPSSSEALNFFKHLQQNSPSQDAQFLSYPFQAVLE 129 Query: 96 LATRHPNSQSELLMLYSFRKSNDCTIPLTAES 1 A R P+S + L LY + S IPLT + Sbjct: 130 QAGREPDSATRLSQLY--QDSKQWEIPLTVNA 159 >gb|KDP28560.1| hypothetical protein JCGZ_14331 [Jatropha curcas] Length = 236 Score = 57.4 bits (137), Expect = 7e-07 Identities = 38/92 (41%), Positives = 49/92 (53%), Gaps = 1/92 (1%) Frame = -3 Query: 273 SSHLRPFLFDSSPLSSHQVLQITLRLASIPKALDFLNYLRANSNA-NTQYLSSVFQGALE 97 ++ L LF S V QI RL S +A FL YL+ S++ +T+ LSS FQ E Sbjct: 62 TAQLNQLLFSDPVPSPRLVFQIARRLPSSSQAFKFLQYLQIKSSSPDTEALSSTFQAIFE 121 Query: 96 LATRHPNSQSELLMLYSFRKSNDCTIPLTAES 1 LA+R PNS+ L LY + S IPLT S Sbjct: 122 LASREPNSRKNLYDLY--KTSKKWNIPLTINS 151 >ref|XP_015899583.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Ziziphus jujuba] Length = 765 Score = 57.8 bits (138), Expect = 1e-06 Identities = 38/90 (42%), Positives = 52/90 (57%), Gaps = 2/90 (2%) Frame = -3 Query: 264 LRPFLF-DSSPLSSHQVLQITLRLASIPKALDFLNYLRANS-NANTQYLSSVFQGALELA 91 LR LF DS+ S ++ +I RL S KAL FL+YL++NS + LSS FQ L +A Sbjct: 73 LRLLLFSDSTTPSPTRLFRIASRLDSSSKALKFLDYLQSNSPTPDKNSLSSTFQAVLVIA 132 Query: 90 TRHPNSQSELLMLYSFRKSNDCTIPLTAES 1 +R P SQS+LL LY + + + A S Sbjct: 133 SREPTSQSKLLELYKASRERGIALTINAAS 162 >ref|XP_021850488.1| pentatricopeptide repeat-containing protein At5g28460-like [Spinacia oleracea] gb|KNA19504.1| hypothetical protein SOVF_060450 [Spinacia oleracea] Length = 765 Score = 57.8 bits (138), Expect = 1e-06 Identities = 41/98 (41%), Positives = 53/98 (54%), Gaps = 2/98 (2%) Frame = -3 Query: 288 DSSPLSSHLRPFLFDSS-PLSSHQVLQITLRLASIPKALDFLNYLRANSNA-NTQYLSSV 115 +S + HL LF +S LSS VLQIT RL AL+F+ LR+NS + LS Sbjct: 72 ESWKTNHHLSQLLFSNSYSLSSDHVLQITRRLGDSSTALNFVQLLRSNSQTPDANLLSFA 131 Query: 114 FQGALELATRHPNSQSELLMLYSFRKSNDCTIPLTAES 1 FQ A ELA+R P + LL L + S + +PLT S Sbjct: 132 FQAAFELASRKPGWKENLLDL--LQTSKELGVPLTVNS 167 >gb|EEF50591.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 346 Score = 57.4 bits (137), Expect = 1e-06 Identities = 37/92 (40%), Positives = 52/92 (56%), Gaps = 1/92 (1%) Frame = -3 Query: 273 SSHLRPFLFDSSPLSSHQVLQITLRLASIPKALDFLNYLRAN-SNANTQYLSSVFQGALE 97 ++ L +F + S + QI RL S +AL FL YL+ N +NTQ+LSS FQ E Sbjct: 77 TTQLNNLIFSALSPSPRLLFQIARRLPSSSQALKFLKYLQNNFPTSNTQHLSSTFQAIFE 136 Query: 96 LATRHPNSQSELLMLYSFRKSNDCTIPLTAES 1 LA+R +S++ L LY + S + IPLT S Sbjct: 137 LASRENDSRTNLYELY--KVSKEWNIPLTINS 166