BLASTX nr result
ID: Astragalus24_contig00021777
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00021777 (482 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004505226.1| PREDICTED: uncharacterized protein LOC101503... 69 1e-10 gb|KHN43069.1| hypothetical protein glysoja_007599, partial [Gly... 59 2e-07 gb|KRH50283.1| hypothetical protein GLYMA_07G213000 [Glycine max] 59 4e-07 ref|XP_006583880.1| PREDICTED: uncharacterized protein LOC100806... 59 4e-07 gb|PNX97696.1| hypothetical protein L195_g020929, partial [Trifo... 57 1e-06 dbj|GAU19936.1| hypothetical protein TSUD_95410 [Trifolium subte... 57 1e-06 ref|XP_003607966.1| hypothetical protein MTR_4g085990 [Medicago ... 56 4e-06 ref|XP_019421412.1| PREDICTED: uncharacterized protein LOC109331... 55 5e-06 ref|XP_019421411.1| PREDICTED: uncharacterized protein LOC109331... 55 5e-06 ref|XP_019421410.1| PREDICTED: uncharacterized protein LOC109331... 55 5e-06 >ref|XP_004505226.1| PREDICTED: uncharacterized protein LOC101503228 [Cicer arietinum] Length = 294 Score = 68.6 bits (166), Expect = 1e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +2 Query: 2 TDVSTSGNSTAESKGHELLSQLPERFHVPKSDLPYFLRDR 121 TDVST+ NST E+KGHELLSQLP RF VPKSDLP FLRDR Sbjct: 255 TDVSTNNNSTPENKGHELLSQLPVRFRVPKSDLPGFLRDR 294 >gb|KHN43069.1| hypothetical protein glysoja_007599, partial [Glycine soja] Length = 219 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +2 Query: 5 DVSTSGNSTAESKGHELLSQLPERFHVPKSDLPYFLRDR 121 DVSTS N+++E+KGHELLS+ P +H P SDLPYFLR R Sbjct: 181 DVSTSSNASSENKGHELLSEPPVSYHFPTSDLPYFLRGR 219 >gb|KRH50283.1| hypothetical protein GLYMA_07G213000 [Glycine max] Length = 264 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +2 Query: 5 DVSTSGNSTAESKGHELLSQLPERFHVPKSDLPYFLRDR 121 DVSTS N+++E+KGHELLS+ P +H P SDLPYFLR R Sbjct: 226 DVSTSSNASSENKGHELLSEPPVSYHFPTSDLPYFLRGR 264 >ref|XP_006583880.1| PREDICTED: uncharacterized protein LOC100806882 isoform X1 [Glycine max] gb|KRH50284.1| hypothetical protein GLYMA_07G213000 [Glycine max] Length = 266 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +2 Query: 5 DVSTSGNSTAESKGHELLSQLPERFHVPKSDLPYFLRDR 121 DVSTS N+++E+KGHELLS+ P +H P SDLPYFLR R Sbjct: 228 DVSTSSNASSENKGHELLSEPPVSYHFPTSDLPYFLRGR 266 >gb|PNX97696.1| hypothetical protein L195_g020929, partial [Trifolium pratense] Length = 236 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +2 Query: 2 TDVSTSGNSTAESKGHELLSQLPERFHVPKSDLPYFLRDR 121 TDVST NST E++G ELLS+LPE F +PKSDLP FL+DR Sbjct: 198 TDVSTVSNSTPENEGQELLSELPESFRIPKSDLP-FLQDR 236 >dbj|GAU19936.1| hypothetical protein TSUD_95410 [Trifolium subterraneum] Length = 290 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +2 Query: 2 TDVSTSGNSTAESKGHELLSQLPERFHVPKSDLPYFLRDR 121 T+VST NST E++GHELLSQLP F VPKSDLP FL+DR Sbjct: 252 TNVSTVSNSTPENEGHELLSQLPASFRVPKSDLP-FLQDR 290 >ref|XP_003607966.1| hypothetical protein MTR_4g085990 [Medicago truncatula] gb|AES90163.1| hypothetical protein MTR_4g085990 [Medicago truncatula] Length = 284 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +2 Query: 2 TDVSTSGNSTAESKGHELLSQLPERFHVPKSDLPYFLRDR 121 TDVST NST E++GHELLSQLPE F VPKS P L DR Sbjct: 245 TDVSTVSNSTPENEGHELLSQLPESFRVPKSVRPCVLMDR 284 >ref|XP_019421412.1| PREDICTED: uncharacterized protein LOC109331405 isoform X3 [Lupinus angustifolius] Length = 276 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +2 Query: 5 DVSTSGNSTAESKGHELLSQLPERFHVPKSDLPYFLRDR 121 DVSTS NS +E+KG +LLS+LPE FH KSDLP FLR R Sbjct: 237 DVSTSTNSNSENKGDKLLSELPESFHFRKSDLPCFLRGR 275 >ref|XP_019421411.1| PREDICTED: uncharacterized protein LOC109331405 isoform X2 [Lupinus angustifolius] Length = 296 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +2 Query: 5 DVSTSGNSTAESKGHELLSQLPERFHVPKSDLPYFLRDR 121 DVSTS NS +E+KG +LLS+LPE FH KSDLP FLR R Sbjct: 257 DVSTSTNSNSENKGDKLLSELPESFHFRKSDLPCFLRGR 295 >ref|XP_019421410.1| PREDICTED: uncharacterized protein LOC109331405 isoform X1 [Lupinus angustifolius] gb|OIV94311.1| hypothetical protein TanjilG_19317 [Lupinus angustifolius] Length = 298 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +2 Query: 5 DVSTSGNSTAESKGHELLSQLPERFHVPKSDLPYFLRDR 121 DVSTS NS +E+KG +LLS+LPE FH KSDLP FLR R Sbjct: 259 DVSTSTNSNSENKGDKLLSELPESFHFRKSDLPCFLRGR 297