BLASTX nr result
ID: Astragalus24_contig00021367
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00021367 (500 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272449.1| LOW QUALITY PROTEIN: uncharacterized protein... 67 1e-09 >ref|XP_020272449.1| LOW QUALITY PROTEIN: uncharacterized protein LOC109847628 [Asparagus officinalis] Length = 574 Score = 66.6 bits (161), Expect = 1e-09 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = +1 Query: 343 DSSIKNEELVEYPKNLEQLNKWTIPSVPPRQIYKMGMFDFISRYAVKTIEQT 498 + +KN +L EYP LE LNKW+ P VP R IYK+G FD+ S A+KT+E+T Sbjct: 500 NEKVKNAQLTEYPSELESLNKWSTPDVPNRDIYKIGFFDYKSLVAIKTLERT 551