BLASTX nr result
ID: Astragalus24_contig00021018
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00021018 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020994820.1| RNA-binding protein 25 isoform X2 [Arachis d... 56 2e-06 >ref|XP_020994820.1| RNA-binding protein 25 isoform X2 [Arachis duranensis] ref|XP_020994821.1| RNA-binding protein 25 isoform X2 [Arachis duranensis] Length = 827 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 241 ILVGHFLLVIRVLLSIQWLYEFQKPTMYATECTLAFC 351 ILVG+F+LV+RVL S+Q YEFQK TM+ATECTLA C Sbjct: 3 ILVGYFVLVVRVL-SLQCFYEFQKSTMFATECTLALC 38