BLASTX nr result
ID: Astragalus24_contig00020995
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00020995 (522 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004503685.1| PREDICTED: BTB/POZ domain-containing protein... 67 7e-10 gb|KHN16799.1| BTB/POZ domain-containing protein [Glycine soja] 66 2e-09 ref|XP_003532421.1| PREDICTED: BTB/POZ domain-containing protein... 66 2e-09 ref|XP_014509532.1| BTB/POZ domain-containing protein At1g63850 ... 66 2e-09 ref|XP_007160095.1| hypothetical protein PHAVU_002G291900g [Phas... 66 2e-09 ref|XP_017442418.1| PREDICTED: BTB/POZ domain-containing protein... 66 2e-09 gb|KYP65660.1| hypothetical protein KK1_011913 [Cajanus cajan] 64 8e-09 ref|XP_020217172.1| BTB/POZ domain-containing protein At1g63850 ... 64 9e-09 gb|PNX94492.1| BTB/POZ domain-containing protein [Trifolium prat... 63 2e-08 ref|XP_013447085.1| BTB/POZ domain plant protein [Medicago trunc... 63 3e-08 ref|XP_003524451.1| PREDICTED: BTB/POZ domain-containing protein... 62 4e-08 dbj|GAU19408.1| hypothetical protein TSUD_76520 [Trifolium subte... 61 1e-07 ref|XP_021887925.1| BTB/POZ domain-containing protein At1g63850 ... 61 1e-07 ref|XP_015896467.1| PREDICTED: BTB/POZ domain-containing protein... 61 1e-07 ref|XP_019421231.1| PREDICTED: BTB/POZ domain-containing protein... 60 2e-07 ref|XP_016189483.1| BTB/POZ domain-containing protein At1g63850 ... 60 2e-07 ref|XP_015954927.1| BTB/POZ domain-containing protein At1g63850 ... 60 2e-07 gb|EXB37314.1| BTB/POZ domain-containing protein [Morus notabilis] 59 6e-07 ref|XP_021820841.1| BTB/POZ domain-containing protein At1g63850 ... 59 6e-07 ref|XP_020419856.1| BTB/POZ domain-containing protein At1g63850 ... 59 6e-07 >ref|XP_004503685.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Cicer arietinum] Length = 609 Score = 67.4 bits (163), Expect = 7e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFWKRNGEQDRTRQLRITTASIE+P Sbjct: 580 VWWRRAFWKRNGEQDRTRQLRITTASIEHP 609 >gb|KHN16799.1| BTB/POZ domain-containing protein [Glycine soja] Length = 429 Score = 65.9 bits (159), Expect = 2e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFWKRNGEQ+RTRQLRITT S+ENP Sbjct: 400 VWWRRAFWKRNGEQERTRQLRITTTSVENP 429 >ref|XP_003532421.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Glycine max] ref|XP_006584729.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Glycine max] gb|KRH41223.1| hypothetical protein GLYMA_08G016800 [Glycine max] gb|KRH41224.1| hypothetical protein GLYMA_08G016800 [Glycine max] Length = 538 Score = 65.9 bits (159), Expect = 2e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFWKRNGEQ+RTRQLRITT S+ENP Sbjct: 509 VWWRRAFWKRNGEQERTRQLRITTTSVENP 538 >ref|XP_014509532.1| BTB/POZ domain-containing protein At1g63850 [Vigna radiata var. radiata] ref|XP_022640082.1| BTB/POZ domain-containing protein At1g63850 [Vigna radiata var. radiata] Length = 607 Score = 65.9 bits (159), Expect = 2e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFWKRNGEQ+RTRQLRITT S+ENP Sbjct: 578 VWWRRAFWKRNGEQERTRQLRITTTSVENP 607 >ref|XP_007160095.1| hypothetical protein PHAVU_002G291900g [Phaseolus vulgaris] gb|ESW32089.1| hypothetical protein PHAVU_002G291900g [Phaseolus vulgaris] Length = 610 Score = 65.9 bits (159), Expect = 2e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFWKRNGEQ+RTRQLRITT S+ENP Sbjct: 581 VWWRRAFWKRNGEQERTRQLRITTTSVENP 610 >ref|XP_017442418.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Vigna angularis] gb|KOM57134.1| hypothetical protein LR48_Vigan11g016600 [Vigna angularis] dbj|BAT73047.1| hypothetical protein VIGAN_01050400 [Vigna angularis var. angularis] Length = 615 Score = 65.9 bits (159), Expect = 2e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFWKRNGEQ+RTRQLRITT S+ENP Sbjct: 586 VWWRRAFWKRNGEQERTRQLRITTTSVENP 615 >gb|KYP65660.1| hypothetical protein KK1_011913 [Cajanus cajan] Length = 590 Score = 64.3 bits (155), Expect = 8e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFWKRNGEQ+RTRQLRITT S ENP Sbjct: 561 VWWRRAFWKRNGEQERTRQLRITTTSAENP 590 >ref|XP_020217172.1| BTB/POZ domain-containing protein At1g63850 [Cajanus cajan] Length = 651 Score = 64.3 bits (155), Expect = 9e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFWKRNGEQ+RTRQLRITT S ENP Sbjct: 622 VWWRRAFWKRNGEQERTRQLRITTTSAENP 651 >gb|PNX94492.1| BTB/POZ domain-containing protein [Trifolium pratense] Length = 597 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIEN 436 VWWRRAFWKRNGEQDRTRQLRIT+ASIE+ Sbjct: 568 VWWRRAFWKRNGEQDRTRQLRITSASIEH 596 >ref|XP_013447085.1| BTB/POZ domain plant protein [Medicago truncatula] gb|KEH21112.1| BTB/POZ domain plant protein [Medicago truncatula] Length = 595 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIEN 436 VWWRRAFWKRNGEQDRTRQLRIT+AS+E+ Sbjct: 566 VWWRRAFWKRNGEQDRTRQLRITSASVEH 594 >ref|XP_003524451.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Glycine max] gb|KRH59948.1| hypothetical protein GLYMA_05G210100 [Glycine max] Length = 564 Score = 62.4 bits (150), Expect = 4e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFWKRNGEQ+RTRQ RI T S+ENP Sbjct: 535 VWWRRAFWKRNGEQERTRQFRIATTSVENP 564 >dbj|GAU19408.1| hypothetical protein TSUD_76520 [Trifolium subterraneum] Length = 541 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIEN 436 VWWRRAFWKRNGE DRTRQLRIT+ASIE+ Sbjct: 512 VWWRRAFWKRNGEHDRTRQLRITSASIEH 540 >ref|XP_021887925.1| BTB/POZ domain-containing protein At1g63850 [Carica papaya] Length = 647 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFWKR+GEQ+R RQLRITTA+I+NP Sbjct: 618 VWWRRAFWKRSGEQERPRQLRITTATIQNP 647 >ref|XP_015896467.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Ziziphus jujuba] Length = 675 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFW+R GEQ+RTR LRITTA+IENP Sbjct: 646 VWWRRAFWRRGGEQERTRPLRITTATIENP 675 >ref|XP_019421231.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Lupinus angustifolius] gb|OIV94917.1| hypothetical protein TanjilG_22114 [Lupinus angustifolius] Length = 543 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFWKRN EQ+R +QLRITTA+IENP Sbjct: 514 VWWRRAFWKRNKEQERAQQLRITTATIENP 543 >ref|XP_016189483.1| BTB/POZ domain-containing protein At1g63850 [Arachis ipaensis] ref|XP_020974808.1| BTB/POZ domain-containing protein At1g63850 [Arachis ipaensis] Length = 586 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFWKRNGEQ++TRQLRIT +++NP Sbjct: 557 VWWRRAFWKRNGEQEQTRQLRITATTVDNP 586 >ref|XP_015954927.1| BTB/POZ domain-containing protein At1g63850 [Arachis duranensis] ref|XP_020994090.1| BTB/POZ domain-containing protein At1g63850 [Arachis duranensis] Length = 586 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIENP 433 VWWRRAFWKRNGEQ++TRQLRIT +++NP Sbjct: 557 VWWRRAFWKRNGEQEQTRQLRITATTVDNP 586 >gb|EXB37314.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 437 Score = 58.9 bits (141), Expect = 6e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIEN 436 VWWRRAFW+R+GEQ+RTR LRITTA+IEN Sbjct: 408 VWWRRAFWRRSGEQERTRSLRITTATIEN 436 >ref|XP_021820841.1| BTB/POZ domain-containing protein At1g63850 [Prunus avium] Length = 643 Score = 58.9 bits (141), Expect = 6e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIEN 436 VWWRRAFW+RNGEQ+R+R LRITTA+IEN Sbjct: 614 VWWRRAFWRRNGEQERSRPLRITTATIEN 642 >ref|XP_020419856.1| BTB/POZ domain-containing protein At1g63850 [Prunus persica] gb|ONI07175.1| hypothetical protein PRUPE_5G104400 [Prunus persica] Length = 643 Score = 58.9 bits (141), Expect = 6e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -1 Query: 522 VWWRRAFWKRNGEQDRTRQLRITTASIEN 436 VWWRRAFW+RNGEQ+R+R LRITTA+IEN Sbjct: 614 VWWRRAFWRRNGEQERSRPLRITTATIEN 642