BLASTX nr result
ID: Astragalus24_contig00020891
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00020891 (703 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004498596.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_013465747.1| PPR containing plant-like protein [Medicago ... 70 5e-10 gb|ACU21279.1| unknown [Glycine max] 64 1e-09 gb|PNY03807.1| pentatricopeptide repeat-containing protein at5g2... 68 2e-09 ref|XP_017433511.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_007133763.1| hypothetical protein PHAVU_011G207000g [Phas... 67 4e-09 gb|KRH13389.1| hypothetical protein GLYMA_15G236000 [Glycine max] 64 3e-08 ref|XP_014621176.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_013465746.1| PPR containing plant-like protein [Medicago ... 63 1e-07 ref|XP_019449378.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_022632230.1| pentatricopeptide repeat-containing protein ... 62 3e-07 gb|KYP55900.1| Pentatricopeptide repeat-containing protein At5g2... 59 1e-06 ref|XP_020227424.1| pentatricopeptide repeat-containing protein ... 59 2e-06 >ref|XP_004498596.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830 [Cicer arietinum] ref|XP_012570709.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830 [Cicer arietinum] Length = 600 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 703 DHVPVQILFNAYCKLEEPVRAFNFYQDWLARKQDS 599 DHVPVQILFN YCKL EP+RAFNFYQDWLA KQDS Sbjct: 563 DHVPVQILFNMYCKLSEPIRAFNFYQDWLASKQDS 597 >ref|XP_013465747.1| PPR containing plant-like protein [Medicago truncatula] gb|KEH39782.1| PPR containing plant-like protein [Medicago truncatula] Length = 589 Score = 69.7 bits (169), Expect = 5e-10 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 703 DHVPVQILFNAYCKLEEPVRAFNFYQDWLARKQDS 599 DHVPVQILFN YCKL EP+RAFNFYQDWL KQDS Sbjct: 552 DHVPVQILFNKYCKLGEPIRAFNFYQDWLKSKQDS 586 >gb|ACU21279.1| unknown [Glycine max] Length = 112 Score = 64.3 bits (155), Expect = 1e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 703 DHVPVQILFNAYCKLEEPVRAFNFYQDWLARKQ 605 DHVPVQI+FN YCKLEEPVRAF FYQDWL K+ Sbjct: 79 DHVPVQIIFNKYCKLEEPVRAFKFYQDWLESKK 111 >gb|PNY03807.1| pentatricopeptide repeat-containing protein at5g24830-like protein [Trifolium pratense] Length = 573 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 703 DHVPVQILFNAYCKLEEPVRAFNFYQDWLARKQDS 599 DHVPVQILFN YCKL EPV+AF FYQDWLA KQDS Sbjct: 536 DHVPVQILFNKYCKLREPVKAFLFYQDWLASKQDS 570 >ref|XP_017433511.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830 [Vigna angularis] gb|KOM49217.1| hypothetical protein LR48_Vigan08g004400 [Vigna angularis] dbj|BAT89271.1| hypothetical protein VIGAN_06018700 [Vigna angularis var. angularis] Length = 582 Score = 67.4 bits (163), Expect = 3e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 703 DHVPVQILFNAYCKLEEPVRAFNFYQDWLARKQDSYHF 590 DHVPVQILFN YCK++EPVRAFNFYQDWL K+ S+ + Sbjct: 545 DHVPVQILFNKYCKMKEPVRAFNFYQDWLESKRGSHPY 582 >ref|XP_007133763.1| hypothetical protein PHAVU_011G207000g [Phaseolus vulgaris] ref|XP_007133764.1| hypothetical protein PHAVU_011G207000g [Phaseolus vulgaris] gb|ESW05757.1| hypothetical protein PHAVU_011G207000g [Phaseolus vulgaris] gb|ESW05758.1| hypothetical protein PHAVU_011G207000g [Phaseolus vulgaris] Length = 582 Score = 67.0 bits (162), Expect = 4e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -1 Query: 703 DHVPVQILFNAYCKLEEPVRAFNFYQDWLARKQDSYHF 590 DH+PVQILFN YCKLEEPVRAFN YQDWL K+ S+ + Sbjct: 545 DHIPVQILFNKYCKLEEPVRAFNLYQDWLESKRGSHPY 582 >gb|KRH13389.1| hypothetical protein GLYMA_15G236000 [Glycine max] Length = 432 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 703 DHVPVQILFNAYCKLEEPVRAFNFYQDWLARKQ 605 DHVPVQI+FN YCKLEEPVRAF FYQDWL K+ Sbjct: 298 DHVPVQIIFNKYCKLEEPVRAFKFYQDWLESKK 330 >ref|XP_014621176.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830-like [Glycine max] gb|KRH20730.1| hypothetical protein GLYMA_13G197400 [Glycine max] gb|KRH20731.1| hypothetical protein GLYMA_13G197400 [Glycine max] gb|KRH20732.1| hypothetical protein GLYMA_13G197400 [Glycine max] gb|KRH20733.1| hypothetical protein GLYMA_13G197400 [Glycine max] gb|KRH20734.1| hypothetical protein GLYMA_13G197400 [Glycine max] Length = 577 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 703 DHVPVQILFNAYCKLEEPVRAFNFYQDWLARKQDS 599 DHVPVQILFN YCKL+EPV AFNFYQDWL K+ S Sbjct: 541 DHVPVQILFNKYCKLKEPVIAFNFYQDWLESKKGS 575 >ref|XP_013465746.1| PPR containing plant-like protein [Medicago truncatula] gb|KEH39783.1| PPR containing plant-like protein [Medicago truncatula] Length = 726 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 703 DHVPVQILFNAYCKLEEPVRAFNFYQDWL 617 DHVPVQILFN YCKL EP+RAFNFYQDWL Sbjct: 533 DHVPVQILFNKYCKLGEPIRAFNFYQDWL 561 >ref|XP_019449378.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830 [Lupinus angustifolius] gb|OIW08080.1| hypothetical protein TanjilG_21060 [Lupinus angustifolius] Length = 598 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -1 Query: 703 DHVPVQILFNAYCKLEEPVRAFNFYQDWLARKQDSYHF 590 DHVPVQILF+ YCK ++PV AFNFYQDWLA K SY + Sbjct: 561 DHVPVQILFSMYCKRKDPVVAFNFYQDWLASKGRSYPY 598 >ref|XP_022632230.1| pentatricopeptide repeat-containing protein At5g24830 isoform X1 [Vigna radiata var. radiata] ref|XP_022632231.1| pentatricopeptide repeat-containing protein At5g24830 isoform X1 [Vigna radiata var. radiata] ref|XP_022632232.1| pentatricopeptide repeat-containing protein At5g24830 isoform X1 [Vigna radiata var. radiata] ref|XP_022632233.1| pentatricopeptide repeat-containing protein At5g24830 isoform X1 [Vigna radiata var. radiata] ref|XP_022632234.1| pentatricopeptide repeat-containing protein At5g24830 isoform X1 [Vigna radiata var. radiata] ref|XP_022632235.1| pentatricopeptide repeat-containing protein At5g24830 isoform X1 [Vigna radiata var. radiata] ref|XP_022632236.1| pentatricopeptide repeat-containing protein At5g24830 isoform X1 [Vigna radiata var. radiata] ref|XP_022632237.1| pentatricopeptide repeat-containing protein At5g24830 isoform X1 [Vigna radiata var. radiata] ref|XP_022632238.1| pentatricopeptide repeat-containing protein At5g24830 isoform X1 [Vigna radiata var. radiata] ref|XP_022632240.1| pentatricopeptide repeat-containing protein At5g24830 isoform X1 [Vigna radiata var. radiata] ref|XP_022632241.1| pentatricopeptide repeat-containing protein At5g24830 isoform X1 [Vigna radiata var. radiata] ref|XP_022632242.1| pentatricopeptide repeat-containing protein At5g24830 isoform X1 [Vigna radiata var. radiata] ref|XP_022632243.1| pentatricopeptide repeat-containing protein At5g24830 isoform X1 [Vigna radiata var. radiata] Length = 585 Score = 61.6 bits (148), Expect = 3e-07 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -1 Query: 703 DHVPVQILFNAYCKLEEPVRAFNFYQDWLARKQDSYHF 590 DHVPVQILFN YCK++EPV+AF+FYQ+WL ++ S+ + Sbjct: 548 DHVPVQILFNKYCKMKEPVKAFHFYQEWLESRRGSHPY 585 >gb|KYP55900.1| Pentatricopeptide repeat-containing protein At5g24830 family [Cajanus cajan] Length = 431 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 Query: 703 DHVPVQILFNAYCKLEEPVRAFNFYQDWLARKQDS 599 DHVPVQILFN +CKLEEPVRAFN YQD L K+ S Sbjct: 394 DHVPVQILFNKFCKLEEPVRAFNIYQDLLESKKAS 428 >ref|XP_020227424.1| pentatricopeptide repeat-containing protein At5g24830 [Cajanus cajan] ref|XP_020227425.1| pentatricopeptide repeat-containing protein At5g24830 [Cajanus cajan] Length = 587 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 Query: 703 DHVPVQILFNAYCKLEEPVRAFNFYQDWLARKQDS 599 DHVPVQILFN +CKLEEPVRAFN YQD L K+ S Sbjct: 550 DHVPVQILFNKFCKLEEPVRAFNIYQDLLESKKAS 584