BLASTX nr result
ID: Astragalus24_contig00020883
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00020883 (334 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU21243.1| unknown [Glycine max] 65 3e-11 gb|KCW49428.1| hypothetical protein EUGRSUZ_K02962 [Eucalyptus g... 65 9e-11 gb|KHN10552.1| 40S ribosomal protein S4 [Glycine soja] 65 1e-10 gb|KZV06739.1| hypothetical protein F511_45779, partial [Dorcoce... 63 1e-10 gb|KHN03095.1| 40S ribosomal protein S4 [Glycine soja] 65 2e-10 ref|XP_006576177.1| PREDICTED: uncharacterized protein LOC100500... 65 2e-10 gb|PKA50993.1| 40S ribosomal protein S4 [Apostasia shenzhenica] 65 2e-10 gb|ACL51789.1| putative ribosomal protein S4, partial [Picea abi... 62 2e-10 ref|XP_010037684.1| PREDICTED: 40S ribosomal protein S4-3 [Eucal... 65 2e-10 ref|NP_001235428.2| putative 40S ribosomal protein S4 [Glycine m... 65 2e-10 ref|XP_003516980.1| PREDICTED: 40S ribosomal protein S4 [Glycine... 65 2e-10 gb|PNX86787.1| 40S ribosomal protein s4-like [Trifolium pratense] 61 4e-10 emb|CDP12458.1| unnamed protein product [Coffea canephora] 61 4e-10 gb|EPS63485.1| hypothetical protein M569_11297, partial [Genlise... 65 5e-10 ref|XP_009393217.1| PREDICTED: 40S ribosomal protein S4-1-like [... 65 5e-10 ref|XP_022864104.1| 40S ribosomal protein S4-like, partial [Olea... 64 5e-10 gb|KJB38001.1| hypothetical protein B456_006G231800 [Gossypium r... 64 5e-10 emb|CBI25428.3| unnamed protein product, partial [Vitis vinifera] 64 6e-10 gb|PKI57690.1| hypothetical protein CRG98_021918 [Punica granatum] 64 6e-10 ref|XP_008809054.1| PREDICTED: 40S ribosomal protein S4-like [Ph... 64 6e-10 >gb|ACU21243.1| unknown [Glycine max] Length = 123 Score = 65.5 bits (158), Expect = 3e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVFIIGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 83 NVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRL 115 >gb|KCW49428.1| hypothetical protein EUGRSUZ_K02962 [Eucalyptus grandis] Length = 187 Score = 65.5 bits (158), Expect = 9e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVFIIGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 147 NVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRL 179 >gb|KHN10552.1| 40S ribosomal protein S4 [Glycine soja] Length = 199 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVFIIGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 159 NVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRL 191 >gb|KZV06739.1| hypothetical protein F511_45779, partial [Dorcoceras hygrometricum] Length = 84 Score = 62.8 bits (151), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVF IGK TKPWVSLPKGKGIKLS+IEEARKR+ Sbjct: 44 NVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRI 76 >gb|KHN03095.1| 40S ribosomal protein S4 [Glycine soja] Length = 246 Score = 65.5 bits (158), Expect = 2e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVFIIGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 206 NVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRL 238 >ref|XP_006576177.1| PREDICTED: uncharacterized protein LOC100500000 isoform X2 [Glycine max] Length = 248 Score = 65.5 bits (158), Expect = 2e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVFIIGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 208 NVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRL 240 >gb|PKA50993.1| 40S ribosomal protein S4 [Apostasia shenzhenica] Length = 250 Score = 65.5 bits (158), Expect = 2e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVFIIGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 206 NVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRL 238 >gb|ACL51789.1| putative ribosomal protein S4, partial [Picea abies] gb|ACL51790.1| putative ribosomal protein S4, partial [Picea glauca] Length = 71 Score = 61.6 bits (148), Expect = 2e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKR 98 NVF IGK TKPWVSLPKGKG+KLS+IEEARKR Sbjct: 32 NVFTIGKGTKPWVSLPKGKGVKLSIIEEARKR 63 >ref|XP_010037684.1| PREDICTED: 40S ribosomal protein S4-3 [Eucalyptus grandis] gb|KCW49427.1| hypothetical protein EUGRSUZ_K02962 [Eucalyptus grandis] Length = 264 Score = 65.5 bits (158), Expect = 2e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVFIIGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 224 NVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRL 256 >ref|NP_001235428.2| putative 40S ribosomal protein S4 [Glycine max] gb|KRH65626.1| hypothetical protein GLYMA_03G050300 [Glycine max] Length = 264 Score = 65.5 bits (158), Expect = 2e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVFIIGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 224 NVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRL 256 >ref|XP_003516980.1| PREDICTED: 40S ribosomal protein S4 [Glycine max] gb|KRH76010.1| hypothetical protein GLYMA_01G124300 [Glycine max] Length = 264 Score = 65.5 bits (158), Expect = 2e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVFIIGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 224 NVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRL 256 >gb|PNX86787.1| 40S ribosomal protein s4-like [Trifolium pratense] Length = 83 Score = 61.2 bits (147), Expect = 4e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKR 98 NVF IGK TKPWVSLPKGKGIKL+VIEEARKR Sbjct: 43 NVFTIGKGTKPWVSLPKGKGIKLTVIEEARKR 74 >emb|CDP12458.1| unnamed protein product [Coffea canephora] Length = 83 Score = 61.2 bits (147), Expect = 4e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVFIIGK KPWVSLPKGKGIKLSVIEE RKR+ Sbjct: 43 NVFIIGKGAKPWVSLPKGKGIKLSVIEEQRKRI 75 >gb|EPS63485.1| hypothetical protein M569_11297, partial [Genlisea aurea] Length = 262 Score = 64.7 bits (156), Expect = 5e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVFIIGK TKPWVSLPKGKGIKLS+IEEARKR+ Sbjct: 223 NVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRI 255 >ref|XP_009393217.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. malaccensis] Length = 265 Score = 64.7 bits (156), Expect = 5e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVF IGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 224 NVFTIGKATKPWVSLPKGKGIKLSIIEEARKRL 256 >ref|XP_022864104.1| 40S ribosomal protein S4-like, partial [Olea europaea var. sylvestris] Length = 186 Score = 63.5 bits (153), Expect = 5e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVF IGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 146 NVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRL 178 >gb|KJB38001.1| hypothetical protein B456_006G231800 [Gossypium raimondii] Length = 191 Score = 63.5 bits (153), Expect = 5e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVF IGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 153 NVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRL 185 >emb|CBI25428.3| unnamed protein product, partial [Vitis vinifera] Length = 246 Score = 64.3 bits (155), Expect = 6e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVFIIGK TKPWVSLPKGKGIKLS+IEEA+KRL Sbjct: 206 NVFIIGKGTKPWVSLPKGKGIKLSIIEEAKKRL 238 >gb|PKI57690.1| hypothetical protein CRG98_021918 [Punica granatum] Length = 199 Score = 63.5 bits (153), Expect = 6e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVF IGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 159 NVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRL 191 >ref|XP_008809054.1| PREDICTED: 40S ribosomal protein S4-like [Phoenix dactylifera] Length = 200 Score = 63.5 bits (153), Expect = 6e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 NVFIIGKVTKPWVSLPKGKGIKLSVIEEARKRL 101 NVF IGK TKPWVSLPKGKGIKLS+IEEARKRL Sbjct: 159 NVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRL 191