BLASTX nr result
ID: Astragalus24_contig00020817
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00020817 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH71336.1| hypothetical protein GLYMA_02G142400 [Glycine max] 84 5e-19 gb|KYP63700.1| Auxin-responsive protein IAA16 [Cajanus cajan] 84 6e-19 gb|ABM53872.1| IAA4, partial [Cestrum elegans] 84 7e-18 gb|ACJ84642.1| unknown [Medicago truncatula] 86 2e-17 gb|ABR25699.1| osiaa30-auxin-responsive aux/iaa gene family memb... 81 2e-17 gb|ANS54460.1| indoleacetic acid-induced protein 16, partial [Ch... 81 2e-17 gb|ABR25977.1| osiaa30-auxin-responsive aux/iaa gene family memb... 81 2e-17 ref|XP_018629378.1| PREDICTED: auxin-responsive protein IAA16-li... 83 3e-17 ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phas... 86 3e-17 ref|XP_022991274.1| auxin-induced protein AUX28-like [Cucurbita ... 84 4e-17 ref|XP_022953249.1| auxin-induced protein AUX28-like [Cucurbita ... 84 4e-17 ref|XP_023547758.1| auxin-induced protein AUX28-like [Cucurbita ... 84 4e-17 ref|XP_014622637.1| PREDICTED: auxin-induced protein AUX28-like ... 84 5e-17 ref|NP_001241599.1| uncharacterized protein LOC100803065 [Glycin... 84 5e-17 ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-li... 84 5e-17 gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremul... 84 5e-17 ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Popu... 84 5e-17 ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [P... 84 6e-17 emb|CBI35213.3| unnamed protein product, partial [Vitis vinifera] 82 6e-17 gb|ABH01143.1| auxin-regulated protein [Populus tomentosa] 84 6e-17 >gb|KRH71336.1| hypothetical protein GLYMA_02G142400 [Glycine max] Length = 53 Score = 84.3 bits (207), Expect = 5e-19 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPW MFVESCKRLRIMKGKEAIGLAPRAVEK KNRS Sbjct: 12 WMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS 53 >gb|KYP63700.1| Auxin-responsive protein IAA16 [Cajanus cajan] Length = 61 Score = 84.3 bits (207), Expect = 6e-19 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPW MFVESCKRLRIMKGKEAIGLAPRAVEK KNRS Sbjct: 20 WMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS 61 >gb|ABM53872.1| IAA4, partial [Cestrum elegans] Length = 149 Score = 84.3 bits (207), Expect = 7e-18 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPWGMFV+SCKRLRIMKG EAIGLAPRAVEK KNRS Sbjct: 108 WMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 149 >gb|ACJ84642.1| unknown [Medicago truncatula] Length = 250 Score = 85.5 bits (210), Expect = 2e-17 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPWGMFVESCKRLRIMKGKEAIG+APRA+EK KNRS Sbjct: 209 WMLVGDVPWGMFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS 250 >gb|ABR25699.1| osiaa30-auxin-responsive aux/iaa gene family member, expressed, partial [Oryza sativa Indica Group] Length = 85 Score = 81.3 bits (199), Expect = 2e-17 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPW MFVESCKRLRIMKG EAIGLAPRA+EK KNRS Sbjct: 44 WMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 85 >gb|ANS54460.1| indoleacetic acid-induced protein 16, partial [Chrysanthemum x morifolium] Length = 87 Score = 81.3 bits (199), Expect = 2e-17 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPW MFV SCKRLRIMKGKEAIGLAPRA+EK KNRS Sbjct: 46 WMLVGDVPWEMFVNSCKRLRIMKGKEAIGLAPRAMEKCKNRS 87 >gb|ABR25977.1| osiaa30-auxin-responsive aux/iaa gene family member, partial [Oryza sativa Indica Group] Length = 87 Score = 81.3 bits (199), Expect = 2e-17 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPW MFVESCKRLRIMKG EAIGLAPRA+EK KNRS Sbjct: 46 WMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 87 >ref|XP_018629378.1| PREDICTED: auxin-responsive protein IAA16-like [Nicotiana tomentosiformis] Length = 151 Score = 82.8 bits (203), Expect = 3e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPWGMFVESCKRLRIMKG EAIGLAP+A+EK KNRS Sbjct: 110 WMLVGDVPWGMFVESCKRLRIMKGTEAIGLAPKAMEKCKNRS 151 >ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris] gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris] Length = 272 Score = 85.5 bits (210), Expect = 3e-17 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPW MFVESCKRLRIMKG EAIGLAPRAVEKRKNRS Sbjct: 231 WMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKRKNRS 272 >ref|XP_022991274.1| auxin-induced protein AUX28-like [Cucurbita maxima] Length = 234 Score = 84.3 bits (207), Expect = 4e-17 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPW MFVESCKRLRIMKGKEAIGLAPRAVEK KNRS Sbjct: 193 WMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS 234 >ref|XP_022953249.1| auxin-induced protein AUX28-like [Cucurbita moschata] Length = 234 Score = 84.3 bits (207), Expect = 4e-17 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPW MFVESCKRLRIMKGKEAIGLAPRAVEK KNRS Sbjct: 193 WMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS 234 >ref|XP_023547758.1| auxin-induced protein AUX28-like [Cucurbita pepo subsp. pepo] Length = 235 Score = 84.3 bits (207), Expect = 4e-17 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPW MFVESCKRLRIMKGKEAIGLAPRAVEK KNRS Sbjct: 194 WMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS 235 >ref|XP_014622637.1| PREDICTED: auxin-induced protein AUX28-like [Glycine max] gb|KHN18836.1| Auxin-induced protein AUX28 [Glycine soja] Length = 246 Score = 84.3 bits (207), Expect = 5e-17 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPW MFVESCKRLRIMKGKEAIGLAPRAVEK KNRS Sbjct: 205 WMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS 246 >ref|NP_001241599.1| uncharacterized protein LOC100803065 [Glycine max] gb|ACU20028.1| unknown [Glycine max] gb|KHN03840.1| Auxin-induced protein AUX28 [Glycine soja] gb|KRH32099.1| hypothetical protein GLYMA_10G031900 [Glycine max] Length = 248 Score = 84.3 bits (207), Expect = 5e-17 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPW MFVESCKRLRIMKGKEAIGLAPRAVEK KNRS Sbjct: 207 WMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS 248 >ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica] Length = 249 Score = 84.3 bits (207), Expect = 5e-17 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPWGMFV+SCKRLRIMKG EAIGLAPRAVEK KNRS Sbjct: 208 WMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 249 >gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides] Length = 249 Score = 84.3 bits (207), Expect = 5e-17 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPWGMFV+SCKRLRIMKG EAIGLAPRAVEK KNRS Sbjct: 208 WMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 249 >ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa] gb|ABK94241.1| unknown [Populus trichocarpa] gb|PNT35068.1| hypothetical protein POPTR_005G053900v3 [Populus trichocarpa] Length = 250 Score = 84.3 bits (207), Expect = 5e-17 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPWGMFV+SCKRLRIMKG EAIGLAPRAVEK KNRS Sbjct: 209 WMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 250 >ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [Prunus mume] Length = 256 Score = 84.3 bits (207), Expect = 6e-17 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPWGMFV+SCKRLRIMKG EAIGLAPRAVEK KNRS Sbjct: 215 WMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 256 >emb|CBI35213.3| unnamed protein product, partial [Vitis vinifera] Length = 170 Score = 82.4 bits (202), Expect = 6e-17 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPW MFVESCKRLRIMKG EAIGLAPRAVEK KNRS Sbjct: 129 WMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS 170 >gb|ABH01143.1| auxin-regulated protein [Populus tomentosa] Length = 258 Score = 84.3 bits (207), Expect = 6e-17 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +3 Query: 3 WMLVGDVPWGMFVESCKRLRIMKGKEAIGLAPRAVEKRKNRS 128 WMLVGDVPWGMFV+SCKRLRIMKG EAIGLAPRAVEK KNRS Sbjct: 210 WMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 251