BLASTX nr result
ID: Astragalus24_contig00020685
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00020685 (856 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP74913.1| Arginine/serine-rich-splicing factor RSP40 [Cajan... 102 3e-21 >gb|KYP74913.1| Arginine/serine-rich-splicing factor RSP40 [Cajanus cajan] Length = 424 Score = 102 bits (255), Expect = 3e-21 Identities = 47/56 (83%), Positives = 49/56 (87%) Frame = +1 Query: 688 HFWTCFEVEILPTSQQRKQNRWRRHSLSTDPP*DLHFWILVLDTNLFITQGFAFIY 855 HFWTCFEVEILPTSQQR+QN WRRHSLS DP LHFW+LVLDTNLF QGFAFIY Sbjct: 37 HFWTCFEVEILPTSQQRQQNGWRRHSLSIDP---LHFWVLVLDTNLFTNQGFAFIY 89