BLASTX nr result
ID: Astragalus24_contig00020552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00020552 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003549564.1| PREDICTED: E3 ubiquitin-protein ligase UPL5-... 58 3e-07 ref|XP_006584091.1| PREDICTED: E3 ubiquitin-protein ligase UPL5-... 57 8e-07 ref|XP_020225689.1| E3 ubiquitin-protein ligase UPL5 [Cajanus ca... 57 8e-07 ref|XP_003529662.1| PREDICTED: E3 ubiquitin-protein ligase UPL5-... 57 8e-07 >ref|XP_003549564.1| PREDICTED: E3 ubiquitin-protein ligase UPL5-like [Glycine max] gb|KRH01992.1| hypothetical protein GLYMA_17G008400 [Glycine max] Length = 867 Score = 57.8 bits (138), Expect = 3e-07 Identities = 34/53 (64%), Positives = 38/53 (71%), Gaps = 10/53 (18%) Frame = +3 Query: 195 MSLIETPWLP---------RHPSKRKFD-EDVKDVSDLVCVRMRKGKAKAVNS 323 MS+IETP + RHPSKRKFD ED +D SDLVCVRMRK +AKAVNS Sbjct: 1 MSVIETPAVHHRSGGSTDHRHPSKRKFDDEDDEDFSDLVCVRMRKDEAKAVNS 53 >ref|XP_006584091.1| PREDICTED: E3 ubiquitin-protein ligase UPL5-like isoform X2 [Glycine max] Length = 843 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/53 (62%), Positives = 38/53 (71%), Gaps = 10/53 (18%) Frame = +3 Query: 195 MSLIETPWLP---------RHPSKRKFD-EDVKDVSDLVCVRMRKGKAKAVNS 323 MS+I+TP + RHPSKRKFD ED +D SDLVCVRMRK +AKAVNS Sbjct: 1 MSVIDTPAVHHRSGGATDHRHPSKRKFDDEDDEDFSDLVCVRMRKDEAKAVNS 53 >ref|XP_020225689.1| E3 ubiquitin-protein ligase UPL5 [Cajanus cajan] Length = 854 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 11/54 (20%) Frame = +3 Query: 195 MSLIETPWLP----------RHPSKRKFD-EDVKDVSDLVCVRMRKGKAKAVNS 323 MS+IETP + RHPSKRKFD E+ +D+SDLVCVRMRK +AKAVNS Sbjct: 1 MSVIETPAVHHRSGGATDHHRHPSKRKFDDEEDEDLSDLVCVRMRKDEAKAVNS 54 >ref|XP_003529662.1| PREDICTED: E3 ubiquitin-protein ligase UPL5-like isoform X1 [Glycine max] gb|KRH51161.1| hypothetical protein GLYMA_07G265600 [Glycine max] Length = 867 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/53 (62%), Positives = 38/53 (71%), Gaps = 10/53 (18%) Frame = +3 Query: 195 MSLIETPWLP---------RHPSKRKFD-EDVKDVSDLVCVRMRKGKAKAVNS 323 MS+I+TP + RHPSKRKFD ED +D SDLVCVRMRK +AKAVNS Sbjct: 1 MSVIDTPAVHHRSGGATDHRHPSKRKFDDEDDEDFSDLVCVRMRKDEAKAVNS 53