BLASTX nr result
ID: Astragalus24_contig00020421
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00020421 (623 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016167521.1| protein RCC2 homolog [Arachis ipaensis] 67 3e-09 ref|XP_015933869.1| protein RCC2 homolog [Arachis duranensis] 67 3e-09 ref|XP_019415447.1| PREDICTED: protein RCC2 isoform X9 [Lupinus ... 64 2e-08 ref|XP_019415446.1| PREDICTED: protein RCC2 isoform X8 [Lupinus ... 64 2e-08 ref|XP_019415445.1| PREDICTED: protein RCC2 isoform X7 [Lupinus ... 64 2e-08 ref|XP_019415444.1| PREDICTED: protein RCC2 isoform X6 [Lupinus ... 64 2e-08 ref|XP_019415443.1| PREDICTED: protein RCC2 isoform X5 [Lupinus ... 64 2e-08 ref|XP_019415442.1| PREDICTED: protein RCC2 isoform X4 [Lupinus ... 64 2e-08 ref|XP_019415441.1| PREDICTED: protein RCC2 isoform X3 [Lupinus ... 64 2e-08 ref|XP_019415440.1| PREDICTED: protein RCC2 isoform X2 [Lupinus ... 64 2e-08 ref|XP_019415439.1| PREDICTED: protein RCC2 isoform X1 [Lupinus ... 64 2e-08 ref|XP_004500953.1| PREDICTED: protein RCC2 homolog [Cicer ariet... 64 3e-08 ref|XP_017436791.1| PREDICTED: protein RCC2 homolog [Vigna angul... 62 2e-07 ref|XP_014502177.1| protein RCC2 [Vigna radiata var. radiata] 62 2e-07 ref|XP_007136067.1| hypothetical protein PHAVU_009G015100g [Phas... 62 2e-07 gb|KYP44824.1| Protein RCC2 [Cajanus cajan] 61 2e-07 ref|XP_019417033.1| PREDICTED: protein RCC2 homolog [Lupinus ang... 61 2e-07 ref|XP_020237311.1| protein RCC2 homolog [Cajanus cajan] 61 2e-07 gb|KHN45908.1| Protein RCC2 [Glycine soja] 61 2e-07 ref|XP_006577976.1| PREDICTED: protein RCC2-like [Glycine max] >... 61 2e-07 >ref|XP_016167521.1| protein RCC2 homolog [Arachis ipaensis] Length = 535 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEVNYTTCGGDFTVWLSSVEG+SI Sbjct: 154 SSPVRCLVSEVNYTTCGGDFTVWLSSVEGSSI 185 >ref|XP_015933869.1| protein RCC2 homolog [Arachis duranensis] Length = 535 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEVNYTTCGGDFTVWLSSVEG+SI Sbjct: 154 SSPVRCLVSEVNYTTCGGDFTVWLSSVEGSSI 185 >ref|XP_019415447.1| PREDICTED: protein RCC2 isoform X9 [Lupinus angustifolius] Length = 451 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV YTTCGGDFTVWLSSVEG+SI Sbjct: 153 SSPVRCLVSEVTYTTCGGDFTVWLSSVEGSSI 184 >ref|XP_019415446.1| PREDICTED: protein RCC2 isoform X8 [Lupinus angustifolius] Length = 455 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV YTTCGGDFTVWLSSVEG+SI Sbjct: 153 SSPVRCLVSEVTYTTCGGDFTVWLSSVEGSSI 184 >ref|XP_019415445.1| PREDICTED: protein RCC2 isoform X7 [Lupinus angustifolius] Length = 460 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV YTTCGGDFTVWLSSVEG+SI Sbjct: 153 SSPVRCLVSEVTYTTCGGDFTVWLSSVEGSSI 184 >ref|XP_019415444.1| PREDICTED: protein RCC2 isoform X6 [Lupinus angustifolius] Length = 521 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV YTTCGGDFTVWLSSVEG+SI Sbjct: 153 SSPVRCLVSEVTYTTCGGDFTVWLSSVEGSSI 184 >ref|XP_019415443.1| PREDICTED: protein RCC2 isoform X5 [Lupinus angustifolius] Length = 525 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV YTTCGGDFTVWLSSVEG+SI Sbjct: 153 SSPVRCLVSEVTYTTCGGDFTVWLSSVEGSSI 184 >ref|XP_019415442.1| PREDICTED: protein RCC2 isoform X4 [Lupinus angustifolius] Length = 529 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV YTTCGGDFTVWLSSVEG+SI Sbjct: 153 SSPVRCLVSEVTYTTCGGDFTVWLSSVEGSSI 184 >ref|XP_019415441.1| PREDICTED: protein RCC2 isoform X3 [Lupinus angustifolius] gb|OIV97600.1| hypothetical protein TanjilG_12357 [Lupinus angustifolius] Length = 530 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV YTTCGGDFTVWLSSVEG+SI Sbjct: 153 SSPVRCLVSEVTYTTCGGDFTVWLSSVEGSSI 184 >ref|XP_019415440.1| PREDICTED: protein RCC2 isoform X2 [Lupinus angustifolius] Length = 533 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV YTTCGGDFTVWLSSVEG+SI Sbjct: 153 SSPVRCLVSEVTYTTCGGDFTVWLSSVEGSSI 184 >ref|XP_019415439.1| PREDICTED: protein RCC2 isoform X1 [Lupinus angustifolius] Length = 538 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV YTTCGGDFTVWLSSVEG+SI Sbjct: 153 SSPVRCLVSEVTYTTCGGDFTVWLSSVEGSSI 184 >ref|XP_004500953.1| PREDICTED: protein RCC2 homolog [Cicer arietinum] Length = 541 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV Y TCGGDFTVWLSSVEGASI Sbjct: 153 SSPVRCLVSEVKYATCGGDFTVWLSSVEGASI 184 >ref|XP_017436791.1| PREDICTED: protein RCC2 homolog [Vigna angularis] gb|KOM51641.1| hypothetical protein LR48_Vigan09g030000 [Vigna angularis] dbj|BAT77704.1| hypothetical protein VIGAN_02029500 [Vigna angularis var. angularis] Length = 545 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV +T CGGDFTVWLSSVEGASI Sbjct: 153 SSPVRCLVSEVKHTACGGDFTVWLSSVEGASI 184 >ref|XP_014502177.1| protein RCC2 [Vigna radiata var. radiata] Length = 546 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV +T CGGDFTVWLSSVEGASI Sbjct: 153 SSPVRCLVSEVKHTACGGDFTVWLSSVEGASI 184 >ref|XP_007136067.1| hypothetical protein PHAVU_009G015100g [Phaseolus vulgaris] gb|ESW08061.1| hypothetical protein PHAVU_009G015100g [Phaseolus vulgaris] Length = 547 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEVN+ CGGDFTVWLSS+EGASI Sbjct: 153 SSPVRCLVSEVNHAACGGDFTVWLSSIEGASI 184 >gb|KYP44824.1| Protein RCC2 [Cajanus cajan] Length = 453 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV +T CGGDFTVWLSS+EGASI Sbjct: 67 SSPVRCLVSEVKHTACGGDFTVWLSSIEGASI 98 >ref|XP_019417033.1| PREDICTED: protein RCC2 homolog [Lupinus angustifolius] Length = 533 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 529 SPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 +PV CLVSEV YTTCGGDFTVWLSS+EG+SI Sbjct: 149 TPVRCLVSEVTYTTCGGDFTVWLSSIEGSSI 179 >ref|XP_020237311.1| protein RCC2 homolog [Cajanus cajan] Length = 537 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV +T CGGDFTVWLSS+EGASI Sbjct: 151 SSPVRCLVSEVKHTACGGDFTVWLSSIEGASI 182 >gb|KHN45908.1| Protein RCC2 [Glycine soja] Length = 538 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV +T CGGDFTVWLSS+EGASI Sbjct: 155 SSPVRCLVSEVKHTACGGDFTVWLSSIEGASI 186 >ref|XP_006577976.1| PREDICTED: protein RCC2-like [Glycine max] gb|KRH61065.1| hypothetical protein GLYMA_04G026100 [Glycine max] Length = 538 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 526 SSPVHCLVSEVNYTTCGGDFTVWLSSVEGASI 621 SSPV CLVSEV +T CGGDFTVWLSS+EGASI Sbjct: 155 SSPVRCLVSEVKHTACGGDFTVWLSSIEGASI 186