BLASTX nr result
ID: Astragalus24_contig00020396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00020396 (309 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU11028.1| hypothetical protein TSUD_113210 [Trifolium subt... 61 4e-09 ref|XP_007154866.1| hypothetical protein PHAVU_003G154400g [Phas... 60 2e-08 dbj|GAU17406.1| hypothetical protein TSUD_232820 [Trifolium subt... 60 3e-08 dbj|GAU18294.1| hypothetical protein TSUD_201820 [Trifolium subt... 60 3e-08 ref|XP_017413108.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-08 ref|XP_003610281.1| pentatricopeptide (PPR) repeat protein [Medi... 60 3e-08 ref|XP_022639568.1| pentatricopeptide repeat-containing protein ... 60 3e-08 gb|PNY05166.1| pentatricopeptide repeat-containing protein at4g3... 60 4e-08 ref|XP_003550682.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-07 ref|XP_019462522.1| PREDICTED: pentatricopeptide repeat-containi... 55 2e-06 gb|OIV99843.1| hypothetical protein TanjilG_26181 [Lupinus angus... 55 2e-06 ref|XP_004507756.1| PREDICTED: pentatricopeptide repeat-containi... 54 3e-06 ref|XP_020231318.1| pentatricopeptide repeat-containing protein ... 54 6e-06 >dbj|GAU11028.1| hypothetical protein TSUD_113210 [Trifolium subterraneum] Length = 186 Score = 60.8 bits (146), Expect = 4e-09 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = +2 Query: 2 RDTMLWNTVINGFV*NCRYEDSIEVFRDMVAQWVQ*DLSNVTAV 133 RDT+LWN++ING V NC Y++S++VFRDM+AQ V+ D S VT V Sbjct: 4 RDTVLWNSMINGLVKNCCYDESVQVFRDMIAQGVRLDSSTVTVV 47 >ref|XP_007154866.1| hypothetical protein PHAVU_003G154400g [Phaseolus vulgaris] gb|ESW26860.1| hypothetical protein PHAVU_003G154400g [Phaseolus vulgaris] Length = 778 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 2 RDTMLWNTVINGFV*NCRYEDSIEVFRDMVAQWVQ*DLSNVTAV 133 RDT+LWNT+I G V NC Y+DS++VFRDMVAQ VQ D + V V Sbjct: 167 RDTVLWNTMITGLVRNCCYDDSVQVFRDMVAQGVQLDSTTVATV 210 >dbj|GAU17406.1| hypothetical protein TSUD_232820 [Trifolium subterraneum] Length = 369 Score = 60.1 bits (144), Expect = 3e-08 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = +2 Query: 2 RDTMLWNTVINGFV*NCRYEDSIEVFRDMVAQWVQ*DLSNVTAVFS 139 RDT+LWN++I+G V NC Y++S++VFRDM+AQ V+ D S V AV S Sbjct: 172 RDTVLWNSMISGLVNNCCYDESVQVFRDMIAQGVRLDSSTVNAVLS 217 >dbj|GAU18294.1| hypothetical protein TSUD_201820 [Trifolium subterraneum] Length = 448 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +2 Query: 2 RDTMLWNTVINGFV*NCRYEDSIEVFRDMVAQWVQ*DLSNVTAV 133 RDT+LWNT+ING V NC ++DSI++F DMVAQ V+ D S VTAV Sbjct: 172 RDTVLWNTMINGLVKNCCFDDSIQLFGDMVAQGVKLDSSAVTAV 215 >ref|XP_017413108.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Vigna angularis] gb|KOM32868.1| hypothetical protein LR48_Vigan01g242400 [Vigna angularis] dbj|BAT76160.1| hypothetical protein VIGAN_01412300 [Vigna angularis var. angularis] Length = 778 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 2 RDTMLWNTVINGFV*NCRYEDSIEVFRDMVAQWVQ*DLSNVTAV 133 RDT+LWNT+I G V NC Y+DS++VFRDMVAQ VQ D + V V Sbjct: 167 RDTVLWNTMITGLVRNCCYDDSVQVFRDMVAQKVQLDSTTVATV 210 >ref|XP_003610281.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|AES92478.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 783 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +2 Query: 2 RDTMLWNTVINGFV*NCRYEDSIEVFRDMVAQWVQ*DLSNVTAV 133 RDT+LWNT+ING V NC ++DSI++FR+MVA V+ D S VTAV Sbjct: 172 RDTVLWNTMINGLVKNCCFDDSIQLFREMVADGVRVDSSTVTAV 215 >ref|XP_022639568.1| pentatricopeptide repeat-containing protein At4g30700 [Vigna radiata var. radiata] Length = 790 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 2 RDTMLWNTVINGFV*NCRYEDSIEVFRDMVAQWVQ*DLSNVTAV 133 RDT+LWNT+I G V NC Y+DS++VFRDMVAQ VQ D + V V Sbjct: 179 RDTVLWNTMITGLVRNCCYDDSVQVFRDMVAQKVQLDSTTVATV 222 >gb|PNY05166.1| pentatricopeptide repeat-containing protein at4g30700-like protein [Trifolium pratense] Length = 783 Score = 59.7 bits (143), Expect = 4e-08 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +2 Query: 2 RDTMLWNTVINGFV*NCRYEDSIEVFRDMVAQWVQ*DLSNVTAV 133 RDT+LWNT+ING V NC ++DSI++F DMVA+ V+ D S VTAV Sbjct: 172 RDTVLWNTMINGLVKNCCFDDSIQLFGDMVAEGVRLDSSTVTAV 215 >ref|XP_003550682.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Glycine max] gb|KRH03024.1| hypothetical protein GLYMA_17G072100 [Glycine max] Length = 778 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = +2 Query: 2 RDTMLWNTVINGFV*NCRYEDSIEVFRDMVAQWVQ*DLSNVTAV 133 RDT+LWNT+I G V NC Y+DS++VF+DMVAQ V+ D + V V Sbjct: 167 RDTVLWNTMITGLVRNCCYDDSVQVFKDMVAQGVRLDSTTVATV 210 >ref|XP_019462522.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Lupinus angustifolius] Length = 793 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = +2 Query: 2 RDTMLWNTVINGFV*NCRYEDSIEVFRDMVAQWVQ*DLSNVTAV 133 RDT+LWNT+I G V NC Y+ S EVFRDMVA V D + V V Sbjct: 182 RDTVLWNTMITGLVRNCCYQSSFEVFRDMVADGVSLDYTTVATV 225 >gb|OIV99843.1| hypothetical protein TanjilG_26181 [Lupinus angustifolius] Length = 2080 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = +2 Query: 2 RDTMLWNTVINGFV*NCRYEDSIEVFRDMVAQWVQ*DLSNVTAV 133 RDT+LWNT+I G V NC Y+ S EVFRDMVA V D + V V Sbjct: 821 RDTVLWNTMITGLVRNCCYQSSFEVFRDMVADGVSLDYTTVATV 864 >ref|XP_004507756.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Cicer arietinum] Length = 783 Score = 54.3 bits (129), Expect = 3e-06 Identities = 24/44 (54%), Positives = 35/44 (79%) Frame = +2 Query: 2 RDTMLWNTVINGFV*NCRYEDSIEVFRDMVAQWVQ*DLSNVTAV 133 RDT+LWN++ING V NC ++D +++F DMVA+ V+ D + VTAV Sbjct: 172 RDTVLWNSMINGLVKNCCFDDCVQLFVDMVAEGVRFDSTTVTAV 215 >ref|XP_020231318.1| pentatricopeptide repeat-containing protein At4g30700 [Cajanus cajan] Length = 776 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = +2 Query: 2 RDTMLWNTVINGFV*NCRYEDSIEVFRDMVAQWVQ*DLSNVTAV 133 RDT+ WNT+I G V NC Y+D+ VFRDMVAQ V+ D + V V Sbjct: 165 RDTVSWNTMITGLVRNCCYDDTFRVFRDMVAQGVRLDSTTVATV 208