BLASTX nr result
ID: Astragalus24_contig00020166
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00020166 (302 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY15014.1| splicing factor U2af large subunit B-like protein... 56 6e-07 >gb|PNY15014.1| splicing factor U2af large subunit B-like protein [Trifolium pratense] Length = 592 Score = 56.2 bits (134), Expect = 6e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -1 Query: 194 MTEEGIMIERKGVNVGLALDLLHHQGIKLSLEQGHVLARK 75 +TEEGIMIERKG++VGL LDL H I LS+EQGH LA++ Sbjct: 91 ITEEGIMIERKGISVGLGLDLFHLLRIDLSMEQGHGLAQR 130