BLASTX nr result
ID: Astragalus24_contig00019953
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00019953 (451 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU27371.1| hypothetical protein TSUD_55240 [Trifolium subte... 57 1e-06 >dbj|GAU27371.1| hypothetical protein TSUD_55240 [Trifolium subterraneum] Length = 466 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +2 Query: 92 TLCLPVLKRFETRHCIWLSEEGVTVKAPLLESIFLEQDTFVS 217 +L LPVL++FETR+C WL E+GV VKAPLL+S+ +EQD S Sbjct: 206 SLILPVLEKFETRNCDWLFEKGVIVKAPLLKSVCIEQDVLPS 247