BLASTX nr result
ID: Astragalus24_contig00019849
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00019849 (492 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003613530.1| disease resistance protein (TIR-NBS-LRR clas... 80 2e-15 dbj|GAU39802.1| hypothetical protein TSUD_219770 [Trifolium subt... 75 1e-14 ref|XP_012568259.1| PREDICTED: toll/interleukin-1 receptor-like ... 78 4e-14 gb|KRH69389.1| hypothetical protein GLYMA_02G023600 [Glycine max] 64 1e-09 >ref|XP_003613530.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] gb|AES96488.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] Length = 212 Score = 80.1 bits (196), Expect = 2e-15 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = +2 Query: 2 LSNIQARNLMCGSGFNSQLWRDLQATNEHLGQLRMEKDTRLLRLPRGV 145 LSN+Q+ NLM GSGFN+QLW DLQATN+HLGQLRM+K+ LLRLPRGV Sbjct: 165 LSNLQSMNLMLGSGFNTQLWHDLQATNQHLGQLRMKKNVILLRLPRGV 212 >dbj|GAU39802.1| hypothetical protein TSUD_219770 [Trifolium subterraneum] Length = 82 Score = 74.7 bits (182), Expect = 1e-14 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +2 Query: 2 LSNIQARNLMCGSGFNSQLWRDLQATNEHLGQLRMEKDTRLLRLPRG 142 LSN+QA NLM GSGFN+QLW DLQATN+HL +LRM+K+ LLRLPRG Sbjct: 35 LSNLQAMNLMRGSGFNTQLWHDLQATNQHLEELRMKKNVILLRLPRG 81 >ref|XP_012568259.1| PREDICTED: toll/interleukin-1 receptor-like protein [Cicer arietinum] Length = 294 Score = 78.2 bits (191), Expect = 4e-14 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = +2 Query: 2 LSNIQARNLMCGSGFNSQLWRDLQATNEHLGQLRMEKDTRLLRLPRGV 145 LSN+QA NLM GSGFN+QLW +LQATN+H+GQLRM+K+ LLRLPRGV Sbjct: 247 LSNLQAMNLMRGSGFNTQLWHELQATNQHIGQLRMKKNVILLRLPRGV 294 >gb|KRH69389.1| hypothetical protein GLYMA_02G023600 [Glycine max] Length = 169 Score = 63.9 bits (154), Expect = 1e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 2 LSNIQARNLMCGSGFNSQLWRDLQATNEHLGQLRMEKDTRL 124 LSN+QA++LM GSGFN+QLWRDLQATN+ L QLRM K RL Sbjct: 121 LSNLQAQHLMMGSGFNTQLWRDLQATNQRLEQLRMGKSVRL 161