BLASTX nr result
ID: Astragalus24_contig00019815
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00019815 (1301 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU10048.1| hypothetical protein TSUD_423680, partial [Trifo... 58 3e-06 dbj|GAU48206.1| hypothetical protein TSUD_304860 [Trifolium subt... 57 8e-06 >dbj|GAU10048.1| hypothetical protein TSUD_423680, partial [Trifolium subterraneum] Length = 166 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/67 (41%), Positives = 39/67 (58%) Frame = +1 Query: 502 VKLPNLFARQHLDQVSFLVMLCDPVGNEFQVIVRKFDGNAYFTTGWRDMGLFYCLHEGGV 681 + PN+FAR ++V L DP+GN+F+V+V K GN Y T GW + FY + G Sbjct: 35 IMFPNMFARDFGNEVRRFATLVDPLGNQFRVLVEKIKGNVYLTWGWFALKDFYNIPVGVW 94 Query: 682 VRLVYVR 702 V L+Y R Sbjct: 95 VLLLYTR 101 >dbj|GAU48206.1| hypothetical protein TSUD_304860 [Trifolium subterraneum] Length = 169 Score = 56.6 bits (135), Expect = 8e-06 Identities = 28/67 (41%), Positives = 39/67 (58%) Frame = +1 Query: 502 VKLPNLFARQHLDQVSFLVMLCDPVGNEFQVIVRKFDGNAYFTTGWRDMGLFYCLHEGGV 681 + LPN+FAR ++V L DP+GN+F+V+V K GN Y T GW + FY + Sbjct: 34 IMLPNMFARDFGNEVRRFATLVDPLGNQFRVLVEKIKGNVYLTWGWFALKNFYNIPVEVW 93 Query: 682 VRLVYVR 702 V L+Y R Sbjct: 94 VLLLYTR 100