BLASTX nr result
ID: Astragalus24_contig00019788
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00019788 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|2M1M|A Chain A, Solution Structure Of The Psiaa4 Oligomeriza... 69 3e-12 ref|XP_013466973.1| auxin response factor [Medicago truncatula] ... 70 5e-12 ref|XP_004498012.1| PREDICTED: auxin-induced protein IAA4-like [... 70 6e-12 gb|AAP13077.1| auxin responsive protein IAA-Re [Gossypium barbad... 67 1e-11 sp|P49679.1|IAA4_PEA RecName: Full=Auxin-induced protein IAA4 >g... 69 1e-11 ref|XP_014512035.1| auxin-induced protein 22B [Vigna radiata var... 69 2e-11 ref|XP_017413350.1| PREDICTED: auxin-induced protein 22B-like [V... 69 2e-11 ref|XP_019428920.1| PREDICTED: auxin-induced protein 22B-like [L... 69 2e-11 ref|XP_007034953.2| PREDICTED: auxin-responsive protein IAA4 [Th... 69 2e-11 ref|XP_007143879.1| hypothetical protein PHAVU_007G109700g [Phas... 69 2e-11 ref|XP_021290455.1| auxin-induced protein 22B-like [Herrania umb... 68 3e-11 ref|XP_004495393.1| PREDICTED: auxin-induced protein 22B-like [C... 68 4e-11 gb|AFK47937.1| unknown [Medicago truncatula] 68 4e-11 gb|KRH34375.1| hypothetical protein GLYMA_10G180000, partial [Gl... 66 4e-11 ref|XP_003535418.1| PREDICTED: auxin-induced protein 22B [Glycin... 66 4e-11 gb|KYP46364.1| Auxin-induced protein 22B [Cajanus cajan] 67 6e-11 gb|AFK43880.1| unknown [Lotus japonicus] 67 6e-11 ref|XP_003520159.1| PREDICTED: auxin-induced protein 22B-like [G... 67 8e-11 gb|PNY02848.1| auxin-induced protein [Trifolium pratense] 67 1e-10 ref|XP_022761106.1| auxin-induced protein 22B-like [Durio zibeth... 67 1e-10 >pdb|2M1M|A Chain A, Solution Structure Of The Psiaa4 Oligomerization Domain Reveals Interaction Modes For Transcription Factors In Early Auxin Response Length = 107 Score = 68.9 bits (167), Expect = 3e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMFVTSCKRLRIMKGTEA+GLGCGV Sbjct: 74 VGDVPWDMFVTSCKRLRIMKGTEAKGLGCGV 104 >ref|XP_013466973.1| auxin response factor [Medicago truncatula] gb|AFK34460.1| unknown [Medicago truncatula] gb|KEH41009.1| auxin response factor [Medicago truncatula] Length = 186 Score = 70.1 bits (170), Expect = 5e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV Sbjct: 156 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 186 >ref|XP_004498012.1| PREDICTED: auxin-induced protein IAA4-like [Cicer arietinum] Length = 195 Score = 70.1 bits (170), Expect = 6e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV Sbjct: 165 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 195 >gb|AAP13077.1| auxin responsive protein IAA-Re [Gossypium barbadense] Length = 91 Score = 66.6 bits (161), Expect = 1e-11 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPW+MF+TSCKRLRIMKG+EARGLGCGV Sbjct: 61 VGDVPWEMFITSCKRLRIMKGSEARGLGCGV 91 >sp|P49679.1|IAA4_PEA RecName: Full=Auxin-induced protein IAA4 emb|CAA48297.1| auxin-induced protein [Pisum sativum] Length = 189 Score = 68.9 bits (167), Expect = 1e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMFVTSCKRLRIMKGTEA+GLGCGV Sbjct: 159 VGDVPWDMFVTSCKRLRIMKGTEAKGLGCGV 189 >ref|XP_014512035.1| auxin-induced protein 22B [Vigna radiata var. radiata] Length = 182 Score = 68.6 bits (166), Expect = 2e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMFVTSCKRLRIMKG+EARGLGCGV Sbjct: 152 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 182 >ref|XP_017413350.1| PREDICTED: auxin-induced protein 22B-like [Vigna angularis] gb|KOM35582.1| hypothetical protein LR48_Vigan02g173200 [Vigna angularis] Length = 190 Score = 68.6 bits (166), Expect = 2e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMFVTSCKRLRIMKG+EARGLGCGV Sbjct: 160 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 190 >ref|XP_019428920.1| PREDICTED: auxin-induced protein 22B-like [Lupinus angustifolius] gb|OIV90721.1| hypothetical protein TanjilG_15107 [Lupinus angustifolius] Length = 192 Score = 68.6 bits (166), Expect = 2e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMFVTSCKRLRIMKG+EARGLGCGV Sbjct: 162 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 192 >ref|XP_007034953.2| PREDICTED: auxin-responsive protein IAA4 [Theobroma cacao] Length = 192 Score = 68.6 bits (166), Expect = 2e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMFVTSCKRLRIMKG+EARGLGCGV Sbjct: 162 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 192 >ref|XP_007143879.1| hypothetical protein PHAVU_007G109700g [Phaseolus vulgaris] gb|ESW15873.1| hypothetical protein PHAVU_007G109700g [Phaseolus vulgaris] Length = 193 Score = 68.6 bits (166), Expect = 2e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMFVTSCKRLRIMKG+EARGLGCGV Sbjct: 163 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 193 >ref|XP_021290455.1| auxin-induced protein 22B-like [Herrania umbratica] Length = 192 Score = 68.2 bits (165), Expect = 3e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMF+TSCKRLRIMKG+EARGLGCGV Sbjct: 162 VGDVPWDMFITSCKRLRIMKGSEARGLGCGV 192 >ref|XP_004495393.1| PREDICTED: auxin-induced protein 22B-like [Cicer arietinum] Length = 183 Score = 67.8 bits (164), Expect = 4e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMFVTSCKRLRIMKG+EARG+GCGV Sbjct: 153 VGDVPWDMFVTSCKRLRIMKGSEARGIGCGV 183 >gb|AFK47937.1| unknown [Medicago truncatula] Length = 186 Score = 67.8 bits (164), Expect = 4e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWD FVTSCKRLRIMKGTEARGLGCGV Sbjct: 156 VGDVPWDTFVTSCKRLRIMKGTEARGLGCGV 186 >gb|KRH34375.1| hypothetical protein GLYMA_10G180000, partial [Glycine max] Length = 122 Score = 66.2 bits (160), Expect = 4e-11 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMFVTSCKRLRIMKG+EARGLGC V Sbjct: 92 VGDVPWDMFVTSCKRLRIMKGSEARGLGCAV 122 >ref|XP_003535418.1| PREDICTED: auxin-induced protein 22B [Glycine max] Length = 125 Score = 66.2 bits (160), Expect = 4e-11 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMFVTSCKRLRIMKG+EARGLGC V Sbjct: 95 VGDVPWDMFVTSCKRLRIMKGSEARGLGCAV 125 >gb|KYP46364.1| Auxin-induced protein 22B [Cajanus cajan] Length = 191 Score = 67.4 bits (163), Expect = 6e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMF+TSCKRLRIMKG+EARGLGCGV Sbjct: 161 VGDVPWDMFMTSCKRLRIMKGSEARGLGCGV 191 >gb|AFK43880.1| unknown [Lotus japonicus] Length = 177 Score = 67.0 bits (162), Expect = 6e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPW+MFVTSCKRLRIMKG+EARGLGCGV Sbjct: 147 VGDVPWEMFVTSCKRLRIMKGSEARGLGCGV 177 >ref|XP_003520159.1| PREDICTED: auxin-induced protein 22B-like [Glycine max] gb|KHN15404.1| Auxin-induced protein 22B [Glycine soja] gb|KRH69048.1| hypothetical protein GLYMA_02G000500 [Glycine max] Length = 192 Score = 67.0 bits (162), Expect = 8e-11 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMF+TSCKRLR+MKG+EARGLGCGV Sbjct: 162 VGDVPWDMFMTSCKRLRVMKGSEARGLGCGV 192 >gb|PNY02848.1| auxin-induced protein [Trifolium pratense] Length = 184 Score = 66.6 bits (161), Expect = 1e-10 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPWDMF TSCKRLRIMKG EARGLGCGV Sbjct: 154 VGDVPWDMFATSCKRLRIMKGAEARGLGCGV 184 >ref|XP_022761106.1| auxin-induced protein 22B-like [Durio zibethinus] Length = 188 Score = 66.6 bits (161), Expect = 1e-10 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 444 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 352 VGDVPW+MF+TSCKRLRIMKG+EARGLGCGV Sbjct: 158 VGDVPWEMFITSCKRLRIMKGSEARGLGCGV 188