BLASTX nr result
ID: Astragalus24_contig00019621
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00019621 (971 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003590171.1| transmembrane protein, putative [Medicago tr... 58 4e-06 >ref|XP_003590171.1| transmembrane protein, putative [Medicago truncatula] gb|AES60422.1| transmembrane protein, putative [Medicago truncatula] Length = 209 Score = 57.8 bits (138), Expect = 4e-06 Identities = 48/138 (34%), Positives = 62/138 (44%) Frame = +3 Query: 360 FMFICSMFLSFCIPCFYVWFVFLVLSYVILCLVVVWLKFTFRVFAEMPLHLWLFWNGWLH 539 F FI MF C ++ F ++ Y CL V + ++F +MP W FW + Sbjct: 78 FSFIVVMF-----DCIFLCFSCVMFFYFCSCLCFVMV--AQKLFVKMPQWCWTFWTRVMC 130 Query: 540 PDSSRARIWVNTNNLINPSYRQDAIIIVVCLDYRETTHSRTVHIPVK*MIHN*IDSKIVD 719 A + V NNL S +Q VV L ETT+SR V VK MI N ID K VD Sbjct: 131 -----AYLKVAANNLYLFSTKQMDSKFVVSLTNFETTYSRYVLAKVKEMILNWIDKKTVD 185 Query: 720 SPSLLAIYHMRKPFAWLI 773 H+RK W+I Sbjct: 186 LLFSFVNDHLRKKLVWVI 203