BLASTX nr result
ID: Astragalus24_contig00018890
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00018890 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013469418.1| E3 ubiquitin ligase PUB14 [Medicago truncatu... 59 1e-07 gb|PKI46746.1| hypothetical protein CRG98_032886 [Punica granatum] 60 1e-07 gb|PNY03127.1| clathrin heavy chain 1-like protein, partial [Tri... 60 1e-07 gb|OWM70219.1| hypothetical protein CDL15_Pgr026069 [Punica gran... 60 1e-07 ref|XP_021897764.1| U-box domain-containing protein 14 [Carica p... 60 1e-07 ref|XP_019434382.1| PREDICTED: U-box domain-containing protein 1... 60 1e-07 dbj|GAU31273.1| hypothetical protein TSUD_39530 [Trifolium subte... 60 1e-07 ref|XP_004496239.1| PREDICTED: U-box domain-containing protein 1... 60 1e-07 dbj|GAV77873.1| Arm domain-containing protein/U-box domain-conta... 60 2e-07 gb|PNX95817.1| U-box domain-containing protein 14-like [Trifoliu... 60 2e-07 ref|XP_022139309.1| U-box domain-containing protein 14 [Momordic... 59 3e-07 gb|PIN05987.1| Ubiquitin--protein ligase [Handroanthus impetigin... 59 3e-07 gb|ESR49719.1| hypothetical protein CICLE_v10030962mg [Citrus cl... 59 3e-07 gb|KDO48789.1| hypothetical protein CISIN_1g006877mg [Citrus sin... 59 4e-07 gb|ESR49718.1| hypothetical protein CICLE_v10030962mg [Citrus cl... 59 4e-07 emb|CBI31426.3| unnamed protein product, partial [Vitis vinifera] 59 4e-07 gb|EEF32796.1| E3 ubiquitin ligase PUB14, putative [Ricinus comm... 59 4e-07 ref|XP_002529604.2| PREDICTED: U-box domain-containing protein 1... 59 4e-07 ref|XP_004250057.1| PREDICTED: U-box domain-containing protein 1... 59 4e-07 gb|KVI06875.1| Armadillo [Cynara cardunculus var. scolymus] 59 4e-07 >ref|XP_013469418.1| E3 ubiquitin ligase PUB14 [Medicago truncatula] gb|KEH43456.1| E3 ubiquitin ligase PUB14 [Medicago truncatula] Length = 200 Score = 58.9 bits (141), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGHRT PKTQ LLHT+LT Sbjct: 12 TYERSCIQKWLDAGHRTCPKTQQTLLHTSLT 42 >gb|PKI46746.1| hypothetical protein CRG98_032886 [Punica granatum] Length = 390 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGHRT PKTQ LLHTALT Sbjct: 32 TYERSCIQKWLDAGHRTCPKTQQTLLHTALT 62 >gb|PNY03127.1| clathrin heavy chain 1-like protein, partial [Trifolium pratense] Length = 417 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGHRT PKTQ LLHTALT Sbjct: 344 TYERSCIQKWLDAGHRTCPKTQQTLLHTALT 374 >gb|OWM70219.1| hypothetical protein CDL15_Pgr026069 [Punica granatum] Length = 626 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGHRT PKTQ LLHTALT Sbjct: 268 TYERSCIQKWLDAGHRTCPKTQQTLLHTALT 298 >ref|XP_021897764.1| U-box domain-containing protein 14 [Carica papaya] Length = 627 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGHRT PKTQ LLHTALT Sbjct: 271 TYERSCIQKWLDAGHRTCPKTQQTLLHTALT 301 >ref|XP_019434382.1| PREDICTED: U-box domain-containing protein 14 [Lupinus angustifolius] gb|OIV89563.1| hypothetical protein TanjilG_19240 [Lupinus angustifolius] Length = 629 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGHRT PKTQ LLHTALT Sbjct: 269 TYERSCIQKWLDAGHRTCPKTQQTLLHTALT 299 >dbj|GAU31273.1| hypothetical protein TSUD_39530 [Trifolium subterraneum] Length = 630 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGHRT PKTQ LLHTALT Sbjct: 271 TYERSCIQKWLDAGHRTCPKTQQTLLHTALT 301 >ref|XP_004496239.1| PREDICTED: U-box domain-containing protein 14 [Cicer arietinum] Length = 630 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGHRT PKTQ LLHTALT Sbjct: 271 TYERSCIQKWLDAGHRTCPKTQQTLLHTALT 301 >dbj|GAV77873.1| Arm domain-containing protein/U-box domain-containing protein/KAP domain-containing protein [Cephalotus follicularis] dbj|GAV77194.1| Arm domain-containing protein/U-box domain-containing protein/KAP domain-containing protein [Cephalotus follicularis] Length = 645 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGHRT PKTQ LLHTALT Sbjct: 267 TYERSCIQKWLDAGHRTCPKTQQTLLHTALT 297 >gb|PNX95817.1| U-box domain-containing protein 14-like [Trifolium pratense] Length = 653 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGHRT PKTQ LLHTALT Sbjct: 294 TYERSCIQKWLDAGHRTCPKTQQTLLHTALT 324 >ref|XP_022139309.1| U-box domain-containing protein 14 [Momordica charantia] ref|XP_022139310.1| U-box domain-containing protein 14 [Momordica charantia] Length = 633 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGH+T PKTQ +LLHTALT Sbjct: 276 TYERSCIQKWLDAGHKTCPKTQQSLLHTALT 306 >gb|PIN05987.1| Ubiquitin--protein ligase [Handroanthus impetiginosus] Length = 359 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGH+T PKTQ LLHTALT Sbjct: 3 TYERSCIQKWLDAGHKTCPKTQQTLLHTALT 33 >gb|ESR49719.1| hypothetical protein CICLE_v10030962mg [Citrus clementina] gb|ESR49720.1| hypothetical protein CICLE_v10030962mg [Citrus clementina] gb|ESR49722.1| hypothetical protein CICLE_v10030962mg [Citrus clementina] gb|KDO48790.1| hypothetical protein CISIN_1g006877mg [Citrus sinensis] gb|KDO48791.1| hypothetical protein CISIN_1g006877mg [Citrus sinensis] gb|KDO48792.1| hypothetical protein CISIN_1g006877mg [Citrus sinensis] Length = 389 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGH+T PKTQ LLHTALT Sbjct: 32 TYERSCIQKWLDAGHKTCPKTQQTLLHTALT 62 >gb|KDO48789.1| hypothetical protein CISIN_1g006877mg [Citrus sinensis] Length = 551 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGH+T PKTQ LLHTALT Sbjct: 194 TYERSCIQKWLDAGHKTCPKTQQTLLHTALT 224 >gb|ESR49718.1| hypothetical protein CICLE_v10030962mg [Citrus clementina] Length = 551 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGH+T PKTQ LLHTALT Sbjct: 194 TYERSCIQKWLDAGHKTCPKTQQTLLHTALT 224 >emb|CBI31426.3| unnamed protein product, partial [Vitis vinifera] Length = 555 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGH+T PKTQ LLHTALT Sbjct: 237 TYERSCIQKWLDAGHKTCPKTQQTLLHTALT 267 >gb|EEF32796.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] Length = 575 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGH+T PKTQ LLHTALT Sbjct: 269 TYERSCIQKWLDAGHKTCPKTQQTLLHTALT 299 >ref|XP_002529604.2| PREDICTED: U-box domain-containing protein 14 [Ricinus communis] Length = 578 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGH+T PKTQ LLHTALT Sbjct: 272 TYERSCIQKWLDAGHKTCPKTQQTLLHTALT 302 >ref|XP_004250057.1| PREDICTED: U-box domain-containing protein 14 isoform X1 [Solanum lycopersicum] Length = 586 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGH+T PKTQ LLHTALT Sbjct: 269 TYERSCIQKWLDAGHKTCPKTQQTLLHTALT 299 >gb|KVI06875.1| Armadillo [Cynara cardunculus var. scolymus] Length = 597 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 374 TYERSCIQQWLDAGHRTYPKTQ*ALLHTALT 466 TYERSCIQ+WLDAGH+T PKTQ LLHTALT Sbjct: 241 TYERSCIQKWLDAGHKTCPKTQQTLLHTALT 271