BLASTX nr result
ID: Astragalus24_contig00018748
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00018748 (321 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU45357.1| hypothetical protein TSUD_239060 [Trifolium subt... 77 5e-14 ref|XP_004516654.1| PREDICTED: protein NLRC3 [Cicer arietinum] 62 9e-09 ref|XP_007157508.1| hypothetical protein PHAVU_002G075500g [Phas... 57 1e-07 >dbj|GAU45357.1| hypothetical protein TSUD_239060 [Trifolium subterraneum] Length = 624 Score = 76.6 bits (187), Expect = 5e-14 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = +3 Query: 180 MAFTSTLSLYSHPQPQVRLRHQRLQALTVTAAQFVWLPILKSR 308 M FTSTLSLYSHPQPQVRLRH+R Q+LTVTA QFVWLP LK R Sbjct: 1 MTFTSTLSLYSHPQPQVRLRHKRSQSLTVTAVQFVWLPTLKRR 43 >ref|XP_004516654.1| PREDICTED: protein NLRC3 [Cicer arietinum] Length = 602 Score = 61.6 bits (148), Expect = 9e-09 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = +3 Query: 180 MAFTSTLSLYSHPQPQVRLRHQRLQALTVTAAQFVWLPILKSRRS 314 MAFTST SLY+HPQ Q RLRH+R Q LTVTA QFV LP RR+ Sbjct: 1 MAFTSTHSLYTHPQQQFRLRHRRSQLLTVTAVQFVLLPTRNRRRT 45 >ref|XP_007157508.1| hypothetical protein PHAVU_002G075500g [Phaseolus vulgaris] gb|ESW29502.1| hypothetical protein PHAVU_002G075500g [Phaseolus vulgaris] Length = 225 Score = 57.4 bits (137), Expect = 1e-07 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = +3 Query: 180 MAFTSTLSLYSHPQPQVRLRHQRLQALTVTA---AQFVWLPILKSRRSRA 320 MAFTSTLSLYSH PQVRLR+QRLQ+L TA AQF LP L RR+R+ Sbjct: 1 MAFTSTLSLYSH--PQVRLRNQRLQSLAFTAAGVAQFAPLPALNCRRTRS 48