BLASTX nr result
ID: Astragalus24_contig00018690
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00018690 (746 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBK55661.1| sulphate transporter [Astragalus drummondii] 55 9e-07 emb|CBK55658.1| sulphate transporter [Astragalus bisulcatus] 55 9e-07 emb|CBK55653.1| sulphate transporter [Astragalus racemosus] 55 9e-07 >emb|CBK55661.1| sulphate transporter [Astragalus drummondii] Length = 662 Score = 55.1 bits (131), Expect(2) = 9e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 506 DRDVNYDGYRNVVFILTLFTGIFQIAFGVFR 414 D +VN+DGYRNVVF +TLF GIFQ+AFGVFR Sbjct: 159 DPNVNHDGYRNVVFTVTLFAGIFQVAFGVFR 189 Score = 26.6 bits (57), Expect(2) = 9e-07 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 319 KFGFHV--VSHVGPIVVGFMAGASHHYWFS*AQERLLGTSHFTN 194 + GF V +SH +VGFMAGA+ + LLG SHFTN Sbjct: 189 RLGFLVDFLSHAA--LVGFMAGAAIMIGLQ-QLKGLLGISHFTN 229 >emb|CBK55658.1| sulphate transporter [Astragalus bisulcatus] Length = 662 Score = 55.1 bits (131), Expect(2) = 9e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 506 DRDVNYDGYRNVVFILTLFTGIFQIAFGVFR 414 D +VN+DGYRNVVF +TLF GIFQ+AFGVFR Sbjct: 159 DPNVNHDGYRNVVFTVTLFAGIFQVAFGVFR 189 Score = 26.6 bits (57), Expect(2) = 9e-07 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 319 KFGFHV--VSHVGPIVVGFMAGASHHYWFS*AQERLLGTSHFTN 194 + GF V +SH +VGFMAGA+ + LLG SHFTN Sbjct: 189 RLGFLVDFLSHAA--LVGFMAGAAIMIGLQ-QLKGLLGISHFTN 229 >emb|CBK55653.1| sulphate transporter [Astragalus racemosus] Length = 662 Score = 55.1 bits (131), Expect(2) = 9e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 506 DRDVNYDGYRNVVFILTLFTGIFQIAFGVFR 414 D +VN+DGYRNVVF +TLF GIFQ+AFGVFR Sbjct: 159 DPNVNHDGYRNVVFTVTLFAGIFQVAFGVFR 189 Score = 26.6 bits (57), Expect(2) = 9e-07 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 319 KFGFHV--VSHVGPIVVGFMAGASHHYWFS*AQERLLGTSHFTN 194 + GF V +SH +VGFMAGA+ + LLG SHFTN Sbjct: 189 RLGFLVDFLSHAA--LVGFMAGAAIMIGLQ-QLKGLLGISHFTN 229