BLASTX nr result
ID: Astragalus24_contig00018612
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00018612 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM25907.1| hypothetical protein LR48_Vigan205s004400 [Vigna ... 80 7e-16 ref|XP_014490153.1| 26S proteasome non-ATPase regulatory subunit... 80 3e-15 ref|XP_007158973.1| hypothetical protein PHAVU_002G197600g [Phas... 80 3e-15 ref|XP_020232965.1| 26S proteasome non-ATPase regulatory subunit... 79 8e-15 gb|OIW00791.1| hypothetical protein TanjilG_19596 [Lupinus angus... 77 9e-15 ref|XP_004498915.1| PREDICTED: 26S proteasome non-ATPase regulat... 78 1e-14 gb|PNY01698.1| 26S proteasome non-ATPase regulatory subunit rpn1... 74 1e-14 dbj|GAU26968.1| hypothetical protein TSUD_06400 [Trifolium subte... 76 2e-14 ref|XP_019464492.1| PREDICTED: 26S proteasome non-ATPase regulat... 77 3e-14 ref|NP_001241171.1| uncharacterized protein LOC100785835 [Glycin... 77 3e-14 gb|KRH58430.1| hypothetical protein GLYMA_05G127300 [Glycine max] 77 3e-14 gb|AFK44112.1| unknown [Lotus japonicus] 74 6e-14 ref|XP_004505436.1| PREDICTED: 26S proteasome non-ATPase regulat... 76 8e-14 ref|XP_003531078.1| PREDICTED: 26S proteasome non-ATPase regulat... 76 8e-14 gb|ACU23821.1| unknown [Glycine max] 76 8e-14 ref|XP_023552682.1| 26S proteasome non-ATPase regulatory subunit... 76 9e-14 gb|ACJ85647.1| unknown [Medicago truncatula] 75 1e-13 gb|POE64267.1| 26s proteasome non-atpase regulatory subunit 8 li... 71 2e-13 ref|XP_015957474.1| 26S proteasome non-ATPase regulatory subunit... 75 2e-13 ref|XP_022985301.1| 26S proteasome non-ATPase regulatory subunit... 75 2e-13 >gb|KOM25907.1| hypothetical protein LR48_Vigan205s004400 [Vigna angularis] Length = 184 Score = 79.7 bits (195), Expect = 7e-16 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQLFDRFKA+FLR+DYD CSNLL QLKVLLTGFRS Sbjct: 1 MDPKLTEVSQLFDRFKASFLRNDYDNCSNLLSQLKVLLTGFRS 43 >ref|XP_014490153.1| 26S proteasome non-ATPase regulatory subunit 8 homolog A [Vigna radiata var. radiata] ref|XP_017406040.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A [Vigna angularis] dbj|BAT74107.1| hypothetical protein VIGAN_01170500 [Vigna angularis var. angularis] Length = 267 Score = 79.7 bits (195), Expect = 3e-15 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQLFDRFKA+FLR+DYD CSNLL QLKVLLTGFRS Sbjct: 1 MDPKLTEVSQLFDRFKASFLRNDYDNCSNLLSQLKVLLTGFRS 43 >ref|XP_007158973.1| hypothetical protein PHAVU_002G197600g [Phaseolus vulgaris] gb|ESW30967.1| hypothetical protein PHAVU_002G197600g [Phaseolus vulgaris] Length = 267 Score = 79.7 bits (195), Expect = 3e-15 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQLFDRFKA+FLR+DYD CSNLL QLKVLLTGFRS Sbjct: 1 MDPKLTEVSQLFDRFKASFLRNDYDNCSNLLSQLKVLLTGFRS 43 >ref|XP_020232965.1| 26S proteasome non-ATPase regulatory subunit 8 homolog A [Cajanus cajan] gb|KYP49636.1| putative 26S proteasome non-ATPase regulatory subunit 8 [Cajanus cajan] Length = 267 Score = 78.6 bits (192), Expect = 8e-15 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQLFDRFK+AFLR DYD CSNLL QLKVLLTGFRS Sbjct: 1 MDPKLTEVSQLFDRFKSAFLRSDYDICSNLLSQLKVLLTGFRS 43 >gb|OIW00791.1| hypothetical protein TanjilG_19596 [Lupinus angustifolius] Length = 190 Score = 77.0 bits (188), Expect = 9e-15 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQ+F+RFKAAF+R+DYD CSNLL QLKVLLTGFRS Sbjct: 1 MDPKLTEVSQIFNRFKAAFVRNDYDNCSNLLSQLKVLLTGFRS 43 >ref|XP_004498915.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Cicer arietinum] Length = 267 Score = 78.2 bits (191), Expect = 1e-14 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQ FDRFKAAFLR+D+D+CSNLL QLKVLLTGFRS Sbjct: 1 MDPKLTEVSQFFDRFKAAFLRNDFDSCSNLLSQLKVLLTGFRS 43 >gb|PNY01698.1| 26S proteasome non-ATPase regulatory subunit rpn12a-like protein [Trifolium pratense] Length = 96 Score = 73.9 bits (180), Expect = 1e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQLFDRFKAA LR+D+D+ SNLL QLKVLLTGFRS Sbjct: 1 MDPKLTEVSQLFDRFKAALLRNDFDSASNLLSQLKVLLTGFRS 43 >dbj|GAU26968.1| hypothetical protein TSUD_06400 [Trifolium subterraneum] Length = 184 Score = 76.3 bits (186), Expect = 2e-14 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQLFDRFKAAFLR+D+D+ SNLL QLKVLLTGFRS Sbjct: 1 MDPKLTEVSQLFDRFKAAFLRNDFDSASNLLSQLKVLLTGFRS 43 >ref|XP_019464492.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Lupinus angustifolius] ref|XP_019464493.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Lupinus angustifolius] Length = 267 Score = 77.0 bits (188), Expect = 3e-14 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQ+F+RFKAAF+R+DYD CSNLL QLKVLLTGFRS Sbjct: 1 MDPKLTEVSQIFNRFKAAFVRNDYDNCSNLLSQLKVLLTGFRS 43 >ref|NP_001241171.1| uncharacterized protein LOC100785835 [Glycine max] gb|ACU17665.1| unknown [Glycine max] gb|KHN25873.1| 26S proteasome non-ATPase regulatory subunit RPN12A [Glycine soja] gb|KRH58429.1| hypothetical protein GLYMA_05G127300 [Glycine max] Length = 267 Score = 77.0 bits (188), Expect = 3e-14 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKL +VSQLFDRFKA+F+R+D+DTCSNLL QLKVLLTGFRS Sbjct: 1 MDPKLKEVSQLFDRFKASFIRNDFDTCSNLLSQLKVLLTGFRS 43 >gb|KRH58430.1| hypothetical protein GLYMA_05G127300 [Glycine max] Length = 274 Score = 77.0 bits (188), Expect = 3e-14 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKL +VSQLFDRFKA+F+R+D+DTCSNLL QLKVLLTGFRS Sbjct: 1 MDPKLKEVSQLFDRFKASFIRNDFDTCSNLLSQLKVLLTGFRS 43 >gb|AFK44112.1| unknown [Lotus japonicus] Length = 169 Score = 74.3 bits (181), Expect = 6e-14 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQ+FDRFKAAF R+D+D CS+LL QLKVLLTGFRS Sbjct: 1 MDPKLTEVSQIFDRFKAAFRRNDFDNCSDLLSQLKVLLTGFRS 43 >ref|XP_004505436.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Cicer arietinum] Length = 267 Score = 75.9 bits (185), Expect = 8e-14 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQLFDRFKAAFLR+D+D+ SNLL QLKVLLTGFRS Sbjct: 1 MDPKLTEVSQLFDRFKAAFLRNDFDSSSNLLSQLKVLLTGFRS 43 >ref|XP_003531078.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Glycine max] gb|KHN39139.1| 26S proteasome non-ATPase regulatory subunit RPN12A [Glycine soja] gb|KRH42301.1| hypothetical protein GLYMA_08G082000 [Glycine max] Length = 267 Score = 75.9 bits (185), Expect = 8e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKL +VSQLFDRFKA+FLR+D+D CSNLL QLKVLLTGFRS Sbjct: 1 MDPKLKEVSQLFDRFKASFLRNDFDNCSNLLSQLKVLLTGFRS 43 >gb|ACU23821.1| unknown [Glycine max] Length = 267 Score = 75.9 bits (185), Expect = 8e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKL +VSQLFDRFKA+FLR+D+D CSNLL QLKVLLTGFRS Sbjct: 1 MDPKLKEVSQLFDRFKASFLRNDFDNCSNLLSQLKVLLTGFRS 43 >ref|XP_023552682.1| 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Cucurbita pepo subsp. pepo] Length = 279 Score = 75.9 bits (185), Expect = 9e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQ FDRFKAAF+RHD D+CSNLL QLKVLLTGFRS Sbjct: 13 MDPKLTEVSQHFDRFKAAFVRHDNDSCSNLLPQLKVLLTGFRS 55 >gb|ACJ85647.1| unknown [Medicago truncatula] Length = 224 Score = 74.7 bits (182), Expect = 1e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPK T+VSQLFDRFKAAFLR+D+D+ SNLL QLKVLLTGFRS Sbjct: 1 MDPKFTEVSQLFDRFKAAFLRNDFDSASNLLSQLKVLLTGFRS 43 >gb|POE64267.1| 26s proteasome non-atpase regulatory subunit 8 like a [Quercus suber] Length = 80 Score = 70.9 bits (172), Expect = 2e-13 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQLF+RFKAAFLR+D+DTC+ LL QLKV LT FRS Sbjct: 1 MDPKLTEVSQLFERFKAAFLRNDFDTCTRLLSQLKVSLTQFRS 43 >ref|XP_015957474.1| 26S proteasome non-ATPase regulatory subunit 8 homolog A [Arachis duranensis] ref|XP_016190520.1| 26S proteasome non-ATPase regulatory subunit 8 homolog A [Arachis ipaensis] Length = 267 Score = 75.1 bits (183), Expect = 2e-13 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 MDPKLT+VSQLF+RFKAAFLR DYDTCSNLL QLKV LT FRS Sbjct: 1 MDPKLTEVSQLFERFKAAFLRKDYDTCSNLLSQLKVKLTEFRS 43 >ref|XP_022985301.1| 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Cucurbita maxima] Length = 267 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 130 MDPKLTKVSQLFDRFKAAFLRHDYDTCSNLLFQLKVLLTGFRS 2 M+PKLT+VSQ DRFKAAF+RHDYD+CSNLL QLKV LTGFRS Sbjct: 1 MEPKLTEVSQHIDRFKAAFVRHDYDSCSNLLSQLKVFLTGFRS 43