BLASTX nr result
ID: Astragalus24_contig00018542
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00018542 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN06300.1| Poly(A) RNA polymerase cid14 [Glycine soja] 56 3e-06 >gb|KHN06300.1| Poly(A) RNA polymerase cid14 [Glycine soja] Length = 1496 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = +1 Query: 292 GWVGLVERVEREKDCMGEHEEWAQPPSGLLPNGLLANE 405 G VG+ K CMGEHE WAQPPSGLLPNGLL NE Sbjct: 68 GEVGIAVHELLAKACMGEHEGWAQPPSGLLPNGLLPNE 105