BLASTX nr result
ID: Astragalus24_contig00018457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00018457 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA67296.1| chloroplast DNA-binding protein PD3 [Pisum sativum] 67 2e-10 ref|XP_013465694.1| transcription factor jumonji (JmjC) domain p... 64 2e-09 ref|XP_003588516.2| transcription factor jumonji (JmjC) domain p... 64 2e-09 dbj|GAU21115.1| hypothetical protein TSUD_10320 [Trifolium subte... 56 1e-06 gb|PNY08717.1| lysine-specific demethylase 3B, partial [Trifoliu... 55 4e-06 >emb|CAA67296.1| chloroplast DNA-binding protein PD3 [Pisum sativum] Length = 1629 Score = 67.0 bits (162), Expect = 2e-10 Identities = 46/93 (49%), Positives = 57/93 (61%), Gaps = 3/93 (3%) Frame = +2 Query: 20 PPGFENYK---ATEVMFADKGSDIINKPPGFEKYKATDVSRRSQETPFETMGQDEVQNDN 190 P G +N K A + +G DII K G E Y+AT VS QE +T+GQDEVQN Sbjct: 556 PKGSKNKKKELADQEHIGHEG-DII-KLIGVENYEATAVSVGDQELVVQTLGQDEVQN-- 611 Query: 191 NFVKPKLGRPKGSKNKEKKIAVEDGSKFDKEKK 289 VKPK+GRPKGSKNK+K I E +K ++KK Sbjct: 612 --VKPKIGRPKGSKNKKKNIDGEAENKLHEKKK 642 >ref|XP_013465694.1| transcription factor jumonji (JmjC) domain protein, putative [Medicago truncatula] gb|KEH39730.1| transcription factor jumonji (JmjC) domain protein, putative [Medicago truncatula] Length = 1692 Score = 64.3 bits (155), Expect = 2e-09 Identities = 34/50 (68%), Positives = 38/50 (76%) Frame = +2 Query: 140 QETPFETMGQDEVQNDNNFVKPKLGRPKGSKNKEKKIAVEDGSKFDKEKK 289 QE +T+ QDEVQN VKPKLGRPKGSKNK+K IA EDG+K KEKK Sbjct: 596 QELHVQTLVQDEVQN----VKPKLGRPKGSKNKKKNIAGEDGNKLHKEKK 641 >ref|XP_003588516.2| transcription factor jumonji (JmjC) domain protein, putative [Medicago truncatula] emb|CAA05489.1| ENBP1 [Medicago truncatula] gb|AES58767.2| transcription factor jumonji (JmjC) domain protein, putative [Medicago truncatula] Length = 1701 Score = 64.3 bits (155), Expect = 2e-09 Identities = 34/50 (68%), Positives = 38/50 (76%) Frame = +2 Query: 140 QETPFETMGQDEVQNDNNFVKPKLGRPKGSKNKEKKIAVEDGSKFDKEKK 289 QE +T+ QDEVQN VKPKLGRPKGSKNK+K IA EDG+K KEKK Sbjct: 605 QELHVQTLVQDEVQN----VKPKLGRPKGSKNKKKNIAGEDGNKLHKEKK 650 >dbj|GAU21115.1| hypothetical protein TSUD_10320 [Trifolium subterraneum] Length = 972 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = +2 Query: 140 QETPFETMGQDEVQNDNNFVKPKLGRPKGSKNKEKKIAVEDGSKFDKEKK 289 QE +T+GQDEVQN +KPK+GRPKGSKN++K IA E ++ KE++ Sbjct: 612 QELAVQTLGQDEVQN----IKPKMGRPKGSKNRKKNIAGEAENELHKERR 657 >gb|PNY08717.1| lysine-specific demethylase 3B, partial [Trifolium pratense] Length = 1588 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +2 Query: 140 QETPFETMGQDEVQNDNNFVKPKLGRPKGSKNKEKKIAVEDGSKFDKEK 286 QE +T+GQDEVQN +KPK+GRPKGSKN++K IA E ++ K+K Sbjct: 551 QELSVQTLGQDEVQN----IKPKMGRPKGSKNRKKNIAGEAQNELHKKK 595