BLASTX nr result
ID: Astragalus24_contig00018432
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00018432 (568 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH62057.1| hypothetical protein GLYMA_04G083000 [Glycine max] 59 3e-09 >gb|KRH62057.1| hypothetical protein GLYMA_04G083000 [Glycine max] Length = 346 Score = 58.9 bits (141), Expect(2) = 3e-09 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 226 KIYFYSTKHFLQNSFPVKTC*EMGYLTFNLVVIVL 122 +IYFYSTKH +QNSFPVKTC EMGYL NL++I + Sbjct: 4 RIYFYSTKHSIQNSFPVKTCSEMGYLAINLMIIFI 38 Score = 30.0 bits (66), Expect(2) = 3e-09 Identities = 19/34 (55%), Positives = 21/34 (61%) Frame = -3 Query: 104 PAQSVTIPSSFHFFIFLKEDLLHIFAHQLYRSLL 3 P QS+T F FI L L+ I AHQLYRSLL Sbjct: 44 PTQSIT--KYFFSFILL---LVQIIAHQLYRSLL 72